KEGG   Oryctolagus cuniculus (rabbit): 100342258
Entry
100342258         CDS       T03373                                 
Symbol
ROBO3
Name
(RefSeq) roundabout guidance receptor 3
  KO
K06755  roundabout, axon guidance receptor 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100342258 (ROBO3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ocu04515]
    100342258 (ROBO3)
Cell adhesion molecules [BR:ocu04515]
 Immunoglobulin superfamily
  ROBO family
   100342258 (ROBO3)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set fn3 C2-set_2 Ig_5 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 100342258
NCBI-ProteinID: XP_017198266
Ensembl: ENSOCUG00000002635
LinkDB
Position
1:complement(92362179..92378853)
AA seq 1420 aa
MLRYLLKTLLQMNLFADSLGADISNSSELLLGGFNSSLAALNHSLLPSGDPSLNVSESER
PAPSLPPGTRVGPEDAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVAT
AREDPRAHRLLLPSGALFFPRIVHGRRARPDEGVYTCVARNYLGAAASRNASLEVAVLRD
DFRQSPANVVVAVGEPAVMECVPPRGHPEPSVSWKKDSARLREEEGRITIRGGKLMMSHT
FKSDAGTYVCVASNMAGERESGGAELVVLERPSFLRRPVNQVVLADAPVTFLCEVQGDPQ
PQLRWRKEEGELPTGRYEIRSDYSLWIGHVSAEDEGTYTCVAENSVGRVEASGSLSVHVP
PQFVTQPRDQMVALGDSVTFQCETRGNPPPAVFWQKEGSQVLLFPSQSLQPTGRFSVSPR
GQLNITQVQSGDAGYYVCQAVSVAGSILAKALLEIKGASLDGLPPVILQGPANQTLALGS
SVWLPCRVTGSPQPSVQWKKDGQWLQGDDLQLNLLANGTLYIADLQEMDMGFYSCVAKSS
IGEATWSGWLRKREDWGVSPGPPIEPSTPPGPPSQPVVTEITKNSITLTWKPSQQAGATA
TSYVIEAFSQAAGSTWRTVADGVQLETHTVSGLRPNTLYLFLVRAVGAWGLSDPSPVSEP
VLTQDSNPSRPSEDPWGGQQGLAEVAVRMQEPIVLEPRTLQVSWTVDGPVQLVQGFRVSW
RIAGSAGGSWTVLDLQSPTQQSAVLRGLPPGSRIQIKVQAQSQEGLGAESPFVTKNIPEE
APSGPPQAVAVALGGDGNSSIIVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGW
ARSAVLGGLLPGLLYRTRVAAATSAGVGVASAPVLVQLPSPPGLEPGLEMGPGLAERLAK
MLREPAFLAGSGAACGALLLGLCAALYRRRKQRKELSHYTASFAYTPAVSFPHSEGLSGA
SSRPTMGLGPGTYPWLADSWPHPSRSPSAQEPRGSCCPSNPNPDDRYYNEAGISLYLAQM
ARGTGATGEGPVYSTIDPAGEELQTFHGGFPQHPSGDPGTWSQYAPPEWSQGDRGARGGK
GKLLGRPVQMPSLNWPEALPPPPPSCELSCPEEPDEGLDGSEPEEWCPPMPERSHLAEPS
ASGGSLVAPPQGETPSPTPSYGEQSTATLTPSPPDPPQAPTHIPHLHQTPRRVPLGPSSP
LSVSQPALSSHEGSPAGLGPDPTTSHHLNPSPAPSTASSTPGRTRQVPGEMTPPLQGPRA
RIRKKLKALPYRKEHSPGDLPPPPLPPPEGEASWALELRAAGSVSSLERERSGERRAVQA
APLGAQRGPQPDEEGWLPYSRPSFLSRGQGASTCSTAGSTSSRGSGSSRGSRGPGRSRSR
SRSQSQRPVQKRREVGAGDPRQRSSGLGRWVGVSGNKKVQ
NT seq 4263 nt   +upstreamnt  +downstreamnt
atgctgcgctacctgctcaaaacgctgctgcaaatgaacttgttcgccgactcgctgggc
gccgacatctccaactccagcgagctgctcttgggcggcttcaactcctcgctggcggcg
ctcaaccacagcctgctgccttctggcgacccctctctcaacgtttccgaatctgaacgc
cctgcgccctccctgcccccagggacaagggtggggccggaggacgccatgccgcgcatc
gtggagcagcctccagatctgctggtctcccgcggcgagccagccacgctgccctgccgc
gccgagggccgcccacgacccaacatcgagtggtacaagaacggggctcgcgtggccact
gcgcgcgaggacccccgcgcgcaccgcctactgctgcccagcggcgccctcttcttcccg
cgcatcgtgcacggacgccgcgcgcggcccgacgagggcgtctacacgtgcgtggcgcgc
aactacttgggggcggcggctagcagaaatgcctcgctggaagtggcagtcctacgcgac
gacttccgacagtctcctgcgaacgtggtggtggccgtcggggagccagccgtgatggaa
tgcgtgccaccgcgcggccacccagagccttccgtgagctggaagaaggacagtgcaagg
ctcagagaggaggagggaagaattacgattcgtggagggaagctgatgatgtcacacaca
ttcaagagtgatgcggggacatatgtgtgcgtggcctccaacatggcaggagaacgggag
agtgggggcgctgagctggtggtactggagcgtccctcattcctgcgcagaccagtgaat
caggtggtcctggctgatgcccctgtgactttcctgtgtgaggtgcagggggacccccag
cctcagctacgctggcgcaaggaggaaggagaactgcccacaggcaggtatgagatccgg
agtgactacagcctttggattgggcacgtgagtgctgaagatgaggggacttacacctgt
gtggcagagaacagcgtgggccgcgtggaagcatctggctccctcagtgtccacgttccc
ccccaatttgtgacccagcccagggaccagatggtggctcttggggacagtgtgactttc
cagtgtgagaccagaggaaacccgccacctgctgtcttctggcagaaggaagggagtcag
gtcctgctcttccccagtcaatcacttcagcccacagggcgcttctccgtctctccaaga
ggccagctcaacatcactcaagtgcagagtggggatgctggctattacgtgtgccaggct
gtcagtgtggctggcagcatcctggccaaggccctgttggagattaaaggagcctccttg
gacgggctgcctcccgtcatcctccagggaccggccaaccagacgctggcacttggctcc
tccgtgtggctgccatgcagagtcactgggagccctcagcccagtgtccagtggaagaag
gatggacagtggctgcagggagatgacctccagctcaacctgctggccaatggcaccctg
tacattgccgacttgcaggagatggacatgggtttctacagttgtgtggccaagagttcc
ataggggaggccacgtggagtggctggcttaggaagcgggaagactggggagtatcgcca
ggtccccctatagaacccagtacccctccaggacctccctctcagccagtggtcactgag
atcaccaagaacagcattaccttgacctggaagcccagccagcaggctggggccacagcc
acctcttacgtgatagaggccttcagccaagcagccggcagcacgtggcggacagtggcc
gatggtgtgcagctggaaacacacactgtcagtggcctgaggcccaataccctctatctg
ttcctggtgcgagccgtgggagcctggggcctcagcgatcccagccctgtctctgagcct
gtcctcacccaggacagcaacccatccaggccatcggaggacccatggggaggccagcag
gggctggctgaagtggctgtgcgcatgcaggagcccatagttcttgagccgcggaccctg
caggtgtcctggactgtggatggcccagtccagctggtgcaaggtttccgggtgtcttgg
aggatagcaggctctgctgggggaagctggacagtgctggatcttcagtccccaacccag
cagagtgctgtgttaagaggactccccccagggtcccgcatccagatcaaggtgcaagct
caaagccaggaggggctgggtgctgagagcccctttgtgacaaagaacattcctgaggag
gcccccagtggtcccccccaggcagtggcagtggccttggggggtgatggcaacagcagt
atcattgtgtcctgggaacctccactcccctcccagcaaaatggggtcatcacagagtat
cagatctggtgcctgggcaacgagagccgcttccaccttaaccggtctgcggcaggctgg
gcgcgctccgcggtgctcgggggactactgcccgggctcctctaccggacccgggtcgcg
gcggccaccagcgctggcgtgggcgtggccagcgccccggtgttggtgcagctgccgtcc
ccgccgggactggagccgggactcgagatgggcccggggctggcggagcggctggctaag
atgctgcgggagccggcctttctggccggcagtggcgcggcctgcggggcgctgctgctc
ggcctctgtgccgccctctaccggcgccggaagcagcgcaaagagctcagtcactacacg
gcttcttttgcctacacacctgcagtgtccttcccacactcagagggcctctctggagcc
agttccaggcccacaatgggccttggcccaggcacctacccatggctggcagactcttgg
cctcacccatctcgaagcccctcagcccaggaacccaggggaagctgctgccccagcaat
cccaaccctgacgacagatattacaatgaagcgggaatctccttatacctggctcagatg
gctcggggcactggtgccaccggcgaggggcctgtctacagcaccattgacccagctggg
gaggagctgcagaccttccacggggggttcccccagcatccctcgggggatccaggcacc
tggagccagtatgccccccctgaatggagccagggggacagaggagccaggggaggcaaa
gggaaacttctgggcagacctgtgcagatgccatctctgaactggccagaagccctgcct
ccacctcccccttcctgtgaactgagctgcccggaggagcccgatgaggggctggatggc
tcagagcccgaagagtggtgcccacccatgcccgagagaagccacctggctgagcccagt
gccagtggagggagcctggttgctccaccccaaggagaaactccctctcccacaccctcc
tatggagagcagtccacagccactcttaccccttcacctcctgacccaccccaggccccc
acccatattccccatctccaccagacaccaaggagggtacccctggggcccagctcccct
ctcagtgtatcccagcctgctctgagtagccatgaagggagtcctgctggcctggggcct
gaccccacaacctcccaccacctgaaccccagccctgcccctagtacagccagcagtacc
ccagggagaacccggcaggtgccaggggagatgactcccccacttcaaggaccccgtgcc
cgcatccggaagaaactcaaggctctcccctacaggaaggagcatagtcctggggacctg
cccccaccccccctgcccccacccgagggagaggcaagctgggccctagagctgagagca
gcaggcagtgtgtcctccctggagcgggaacgcagtggagagaggagagcggtacaggca
gcgcccctgggtgcccagcgggggccccagccagatgaggagggctggctcccgtacagc
agaccgagcttcctgtcccggggccagggtgccagcacctgttccacagctggcagcacc
tcttccagaggctccggcagctctcggggctcccggggccctggccggagccggagccgg
agccggagccagagccaaaggcctgtacagaaacgccgagaggtgggggctggagatccc
agacagaggagcagtgggctagggaggtgggtgggggtgtctggaaacaagaaggtacaa
tag

DBGET integrated database retrieval system