Oryctolagus cuniculus (rabbit): 100342268 Help Entry 100342268         CDS       T03373                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00480   Glutathione metabolism ocu00980   Metabolism of xenobiotics by cytochrome P450 ocu00982   Drug metabolism - cytochrome P450 ocu00983   Drug metabolism - other enzymes ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu05200   Pathways in cancer ocu05204   Chemical carcinogenesis - DNA adducts ocu05215   Prostate cancer ocu05225   Hepatocellular carcinoma ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100342268   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100342268    00982 Drug metabolism - cytochrome P450     100342268    00983 Drug metabolism - other enzymes     100342268  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100342268    05204 Chemical carcinogenesis - DNA adducts     100342268   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100342268    05215 Prostate cancer     100342268   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100342268   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100342268  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ocu02000]     100342268 Enzymes [BR:ocu01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100342268 Transporters [BR:ocu02000]  Other transporters   Pores ion channels [TC:1]    100342268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_N_2 GST_N_3 GST_C_2 Motif Other DBs NCBI-GeneID:  100342268 NCBI-ProteinID:  XP_002724318 Ensembl:  ENSOCUG00000002230 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTIVYFPVQGRCEAMRMLLTDQGQSWKEEVVNLETWSQGSLKASCLYGQLPKLQDGD LTLYQSNAILRHLGRTLGIYGKDQREAALLDMVNDGVEDLRIKYITLIYTNYDAGKDSYV KALPGHLKPFETLLSQNKDGKSFIVGDQISFADYNLLDLLLTHQILAPGCLDAFPLLSAY VARLSARPKLKAFLASPEHVNRPINANGKK NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccatcgtctacttcccagttcaagggcgctgcgaggccatgcgcatg ctgctgaccgaccagggccagagctggaaggaggaggtggtgaacctggagacctggtcg cagggctccctcaaggcctcctgtctgtacgggcagctgcccaagttgcaggacggagac ctcaccctgtaccagtccaatgccatcctgcgccacctgggccgcaccctcgggatctat gggaaggaccagcgggaggccgccctgctggacatggtgaatgacggcgtggaggacctg cgcatcaagtacatcaccctcatctacaccaactacgacgcgggcaaggacagctacgtg aaggccctgcccgggcacctcaagccttttgagaccctgctgtcccagaacaaggatggc aagtccttcatcgtgggcgaccagatctccttcgccgactacaacctgctggacttgttg ctaacgcaccagatcctggcccccggctgcctggacgccttccccctgctctcggcctac gtggcccgcctcagtgcccggcccaagctcaaggccttcctggcctcgcccgaacacgtg aaccgccccattaacgccaacgggaaaaagtga

DBGET integrated database retrieval system