KEGG   Oryctolagus cuniculus (rabbit): 100342311
Entry
100342311         CDS       T03373                                 
Symbol
ANAPC10
Name
(RefSeq) anaphase promoting complex subunit 10
  KO
K03357  anaphase-promoting complex subunit 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342311 (ANAPC10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342311 (ANAPC10)
   04114 Oocyte meiosis
    100342311 (ANAPC10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100342311 (ANAPC10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100342311 (ANAPC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342311 (ANAPC10)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100342311 (ANAPC10)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100342311 (ANAPC10)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100342311 (ANAPC10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 100342311
NCBI-ProteinID: XP_008265617
Ensembl: ENSOCUG00000001819
UniProt: G1SG69
LinkDB
Position
15:19564191..19676952
AA seq 185 aa
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGRFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccacaccaaacaagacgcctcctggtgctgaccctaaacaattggaaaggactgga
acagtacgggaaattgggtcacaagctgtttggtcactttcatcttgcaaaccaggattt
ggagtggatcagttaagagatgacaatcttgaaacttactggcaatcagacggctcccag
cctcatttagtgaacatccaattcagaagaaagacaacagtgaagacattatgtatttat
gcagactacaaatctgatgaaagctatactccaagcaagatctcagtcagagtaggaaat
aattttcacaaccttcaagaaattcggcaacttgaattggtggaaccaagtggctggata
catgttcctttaactgataatcataagaagccaactcgcaccttcatgatacagattgct
gttctagccaatcaccaaaatggaagagacactcacatgagacaaattaaaatatacaca
ccagtggaggagagctccattggtagatttcctagatgtacaactattgatttcatgatg
tatcgttcaataaggtga

DBGET integrated database retrieval system