KEGG   Oryctolagus cuniculus (rabbit): 100342334
Entry
100342334         CDS       T03373                                 
Symbol
TNFSF15
Name
(RefSeq) tumor necrosis factor superfamily member 15
  KO
K05478  tumor necrosis factor ligand superfamily member 15
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342334 (TNFSF15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100342334 (TNFSF15)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100342334 (TNFSF15)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100342334
NCBI-ProteinID: XP_002720561
LinkDB
Position
Un
AA seq 275 aa
MGGSLHPGGVRDTSRTSGSMAENLGLDFGETASVEMLPQDGTCRPKARARLEARNSSASW
ALTCCLVFLSILIGLSAYLLVGQLQTQGEACVQFQTLKGREFGPSQQRAYMPLRADGNKP
RAHLTAVKQTPTQPLRNHFPALHWEHELGLAFTKNRMNYTNKFLVIPESGDYFVYSQVTF
RGTTSECGVINQRRRQTKPDSIVVVITKVTDNYPEPAQLLTGTKSVCEMGNWFQPIYLGA
MFSLEEGDKLMVNVSDVSLVDYTKEDKTFFGAFLL
NT seq 828 nt   +upstreamnt  +downstreamnt
atgggggggtctctccacccaggaggagtcagagacacctccaggaccagcgggagtatg
gcagagaatctgggactggactttggggaaacagccagtgtggaaatgctgccccaggat
ggcacctgcaggcccaaagccagagccaggctggaagccaggaacagcagcgcaagctgg
gctctcacctgctgcctggtgtttctctccatcctcatcggactcagtgcctacctgctc
gttggccagctccagacacagggagaagcctgtgtacagttccagactctaaaaggacgg
gaatttggaccttcacaacagagagcttacatgcctctcagagctgatggaaataagcca
agggcacacctgacagctgtgaaacaaactcccacacagcccttgagaaatcactttcca
gctctgcattgggaacatgagctaggcttggccttcaccaagaaccggatgaactacacc
aataaattcctggtgatcccagagtcgggagactactttgtttactcccaggtcacattc
cgagggaccacatctgagtgtggtgtcatcaaccaaaggagacgacagaccaaaccagac
tccatcgttgtggtcatcaccaaggtaacagacaactaccccgagcctgcccagcttcta
acaggaaccaagtctgtgtgtgaaatgggcaactggttccagcccatctacctcggggcc
atgttctccttggaagaaggggacaagctgatggtgaatgtcagtgacgtctccttggtc
gattacacaaaggaagacaaaactttctttggtgccttcttgctgtag

DBGET integrated database retrieval system