KEGG   Oryctolagus cuniculus (rabbit): 100342396
Entry
100342396         CDS       T03373                                 

Symbol
PRF1
Name
(RefSeq) perforin 1
  KO
K07818  perforin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04210  Apoptosis
ocu04650  Natural killer cell mediated cytotoxicity
ocu04940  Type I diabetes mellitus
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100342396 (PRF1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100342396 (PRF1)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100342396 (PRF1)
   05330 Allograft rejection
    100342396 (PRF1)
   05332 Graft-versus-host disease
    100342396 (PRF1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100342396 (PRF1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100342396 (PRF1)
SSDB
Motif
Pfam: MACPF C2 DUF4657
Other DBs
NCBI-GeneID: 100342396
NCBI-ProteinID: XP_008268230
Ensembl: ENSOCUG00000006954
LinkDB
Position
18
AA seq 555 aa
MATGLLLPGFLLLLLPPPTPAPCYTAARSECKRVRRFVPGAWLAGEGVDVTSLRRSGSFP
VDTRRFLRPDGTCTLCKNLLQQGALQYLPLAFTHWRAQGSGCQRHVARAKVSSTEEVARD
AANSIKNDWRVGLDVNPKPSSNVQMSVAGSHSQEANFAAQKTHQDQYSFNTDSVECRLYS
FHLVHKPPLHPDFSRALRDLPPDFNTSTEPYYHRLITNYGTHFIRAVELGGRISALTALR
TCQLVLDGFTTDEVGDCLTVEAQVSIGGQASTSSEYKACQDKKQKHKMTTSFHQTFHERH
SQVVGGHHTSMHDLLFGRQAGPEQFSAWVASLSASPGLVDYSLEPLHLLLESQDPRREAL
RQAVSKYLMGRARWRDCSRPCPPGQQKNPHNPCECQCSSSEVTSQDCCPRKRGLARLEVM
NFQATGLWGDWITATDAYVKVFFGDQQMRTDTVWNNNNPRWTTRLDFGDVTLAGQGPLRV
QVWDADYGWDDDLLGTCDQSPKSGSHMVSCNLNHGHLRFLYRAICLPHLGGETCLEYAPQ
GLLGEPPGNRSGAVW
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggcgaccggcctgctcctcccgggcttcctcctgctgctgctgcccccgcccactccg
gccccctgctacacagctgcacgctcagagtgcaaacgtgtgcgcaggtttgtgcccgga
gcgtggctggccggagaaggtgtggatgtgaccagcctccggcgctcgggctccttcccg
gtggacacacgcaggttcctgaggcccgatggcacctgtaccctctgtaaaaacctccta
cagcagggtgccctgcagtacctgcccctggcattcacccactggcgtgcccaaggctcc
ggctgccagcgccacgtggcgagggccaaagttagctccacggaggaggtggcccgggac
gcggctaacagcatcaaaaacgactggcgagtgggactggacgtgaatcccaagcccagc
agcaatgtccagatgtccgtggccggctcacactcccaggaggccaacttcgcagctcag
aagactcaccaggaccagtacagcttcaacacggactcagtggagtgtcgcttgtacagt
tttcacctggtgcacaagcccccgctgcaccctgacttcagcagggccctcagggacctg
ccccccgatttcaacacctccacggagccctactaccacaggctcatcaccaactatggc
acccacttcatccgggccgtggagctgggcggccgcatctcagccctcaccgccctgcgc
acctgccagctggtcctggatgggttcacaaccgatgaggtgggggactgcctgacggtg
gaggcccaggtcagcatcggcgggcaggccagcacctcctctgagtataaggcctgccag
gacaagaagcagaagcacaagatgaccacctccttccaccagaccttccatgaacgccac
tcccaagtggttggcggccaccacacctccatgcacgacctgctgtttgggcgccaggcc
gggcctgagcagttctccgcctgggtggcctcactctccgctagccctggcctggtggac
tacagcctggagcccctgcacctgctcctggagagccaggacccgcggcgggaggctctg
aggcaggcagtgagcaagtacctgatgggcagggcacgctggagggactgcagccggccc
tgccccccagggcagcagaagaatccccacaacccatgcgagtgccagtgctccagctca
gaggtcaccagtcaggactgctgtccacggaagcggggcctggcccggctggaggtcatg
aacttccaggccacaggcctgtggggggattggatcacggccacggatgcctatgtgaag
gtcttcttcggtgaccagcagatgaggacggacaccgtgtggaacaacaacaatcccagg
tggacgacacgcctggacttcggggacgtgaccctggccggacagggacccctcagggtg
caggtctgggatgcggactatggctgggatgacgacctccttggcacctgtgaccagtct
ccgaagtcgggctcacatatggtgagctgcaacctgaaccatggccatctgaggttcctc
taccgtgccatatgcttgccccacctgggaggggaaacctgcctggaatatgccccccag
gggcttttgggggagccccctgggaaccggagtggggctgtgtggtga

DBGET integrated database retrieval system