KEGG   Oryctolagus cuniculus (rabbit): 100342432
Entry
100342432         CDS       T03373                                 
Symbol
BIRC6
Name
(RefSeq) baculoviral IAP repeat containing 6
  KO
K10586  baculoviral IAP repeat-containing protein 6 (apollon) [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342432 (BIRC6)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100342432 (BIRC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100342432 (BIRC6)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342432 (BIRC6)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100342432 (BIRC6)
Peptidases and inhibitors [BR:ocu01002]
 Peptidase inhibitors
  Family I32: IAP family
   100342432 (BIRC6)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100342432 (BIRC6)
SSDB
Motif
Pfam: BIRC6 UQ_con BIR UEV
Other DBs
NCBI-GeneID: 100342432
NCBI-ProteinID: XP_008252787
Ensembl: ENSOCUG00000006600
LinkDB
Position
2:complement(153752180..154001166)
AA seq 4877 aa
MVTGGGAAPPGTVTEPLPSVIVQSAGRKMAAAAAAASGPGCSSVAAAAGAGAGAAGVSEW
LVLRDGCMRCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQV
KCQYISAVDKVVFVDDYAVGCRKDLNGILLLDTALQTPVAKQDDVVQLELPVTEAQQLLS
ACLEKVDISSTEGYDLFITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSIASAI
VNELKKINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRSLMYSEANRRETFTS
WPHVGYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNC
PFVKGEHTQNVPLSVTLATSPAQFPCTDGTDRISCFGSGSCPQFLAAATKRGKICIWDVS
KLMKVHLKFEINAYDPAIVQQLILSGEPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDD
LLEDSDSEEHSRSDSVTGHTSQKEAMEISLDVTALSILQQPEKLQWEIVANVLEDTVKDL
EELGANPCLTNSKNEKTKEKHQEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLS
RTQGESISEQGSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSK
SLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAAAGLASPDSEKWNSVFPKPGT
LVQCLRLPKFAEEENLCVDSITPCADGIHLLVGLRTCPVESLSAINQVEALNNLNKLNSA
LCSRRKGELESNLAVVNGANLSVIQHESPADVQTPLIIQPEQRNVSGGYLVLYKMNYATR
IVTLEEEPIKIQHIKDPQDTITSLILLPPDILDNREDDYEEPAEEMQLTSKNGIERERKS
DISTLGHLVITTQGGYVKILDLSNFEILAKVEPPKKEGTEEQDTFVSVIYCSGTDRLCAC
TKGGELHFLQIGGTCDDIDEADILVDGSLSKGIEPSSEGSKPLSNPSSPGISGVDLLVDQ
PFTLEILTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTR
TWKLQTDGNSWDEHVFELVLPKACMVGHVDFKFVLNSNITNIPQIQVTLLKNKAPGLGKV
NALNIEVEQNGKPSLVDLNEEMQHMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLS
GHAGMLTLTSPKLVKGMAGGKYRSFLIHVKAVNERGTDDICNGGVRPVVRLPSLKHQSTK
GYSLASLLAKVAAGKEKSSNVKNENASGTRKSENLRGCDLLQEVSVTIRRFKKTSISKER
VQRCAMLQFSEFHEKLLNTLCRKVDDGQITEHAQSLVLDTLCWLAGVHSNGPGSSKEGNE
SLLSKTRKCLSDIVRVCFFEAGRSIAHKCARFLALCISNGKCDPCQPGFGSVLLKALLDN
MAFLPAAATGGSVYWYFVLLNYVKDEDLAGCSTACASLLTAVSRQLQDRLTPMEALLQTR
YGLYSSPFDPVLFDLEMSGSSCKNVYNSSIGVQSDEIDLSDVLSGSGKVSSCTAAEGSFT
SLTGLLEVEPLHFTCVSTSDGTRIERDDAMSSFGVTPAVGGLSSGTVGEASTALSSAAQV
ALQSLSHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAASAVGPV
HNSVPSNPVAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQLFPGSV
IDPPTVNLAAHNKNSNKSRMNPLGSGLALAISHASHFLQPPPHQSIIIERMHSGARRFVT
LDFGKSILLTDVLIPTCGDLASLSIDIWTLGEEMDGRRLVVATDISTHSLILHDLIPPPV
CRFMKITVIGRYGSTNARAKIPLGFYYGHTYILPWESELKLMHDPLRGEGESANQPEIDQ
HLTMMVALQEDIQCRYNLACHRLEALLQSIDLPPLNSANNAQYFLRKPDKAVEEDSRVFS
AYQDCIQLQLQLNLAHNAVQRLKVALGSSRKMLSETSDPEDLIQMSSTEQLRTIIRYLLD
TLLSLLHSSSGHSVPAVLQSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLCGGERWW
GQFLSNVLQELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLLSPLQPQ
LPMHRRTEGVLDIPMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGKDRERFLTGNQWSF
INNNLHTQSLTRSSKGSSSLDRLYSRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQS
NKGSSYKLLVEQAKLKQATSKHFKDLIRLRRTAEWSRSNLDTEVTTTKESPEIEPLPFTL
AHERCISVVQKLVLFLLSMDFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEPQLERL
LLLLVGTDFNRGDISWGGAWAQYSLTCMLQDILAGELLAPVAAEAMEEGTVSDDVGATAG
DSDDSLQQSAVQLLETIDEPLTHDITGAPPLSSLEKDKEIDLELLQDLMEVDIDPLDIDL
EKDPLAAKVFKPISSTWYDYWGADYGTYNYNPYIGGLGIPVAKPPANTEKNGSQTVSVSV
SQALDARLEVGLEQQAELMLKMMSTLEADSILQALTNTSPTLSQSPTGTDDSLLGGFQAV
NQTSQLIIQLSSVPMLNVCFNKLFSMLQVHHVQLESLLQLWLTLSLNSSSSGNKENGADI
FLYNANRVPIISLNQASITSFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGCSNAIG
TQESTAHLLVSDPNLIHVLVKFLSGTSPHGTNQHSPQVGPTATQAMQEFLTRLQVHLSST
CPQIFSEFLLKLVHILSTERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESV
TFLVHHYITCSDKVMSRSGSDSSVGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLL
KLVNILVQLPLSGNREYSARVSVTSNTTDSVSDEEKVSGGKDVNGSSTSTQGSPAYVADL
VLANQQIMSQILSALGLCNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFSILTTL
SKKASTVHMMLQPILTYMACGYMGRQGSLATCQLSEPLLWFILRVLDTSDALKAFHDMGG
VQLICNNMVTSTRAIVNTARSMVSTIMKFLDSGPNKAVDSTLKTRILASEPDNAEGIHNF
APLGTITSSSPTAQPAEVLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPAAVLLKEI
HIQPHLASLATCPSSVSVEVSADGVNMLPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLH
RPRDASTLGLSQIKLLGLTAFGTTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISD
LEGMMASAAAPTANLLQTCAALLMSPYCGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRN
CAASGSDPTDLNSPLLFGRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSAKV
AAMKRSGRMNYMCPNYSAIEYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLDRELFE
LLFNWSMSLPCNMVLKKAVDSLLCSMCHIHPSYFSLLMGWMGITPPPVQCHNRLSMTDDS
KKQDLSSSLTDDSKNAQAPLTLTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLASFC
FSHISYSENIAQSIDVSQDKLRRHHVPQQCSKMPITADLVAPVLRFLTEVGNSHIMKDWL
GGSEVNPLWTALLFLLCHPGSASGAHNLGAQQTSVRSTSLSSAATTGLTTQQRTAIENAT
VAFFLQCISCHPNNQKLMAQVLCELFQTAPQRGNLPTSGNISGFIRRLFLQLMLEDEKVT
MFLQSPCPLYKGRINATSHVIQHPMYGAGHKFRTLHLPVSTTLSDVLDRVSDTPSITAKL
ISEQKDDKEKKNHEEKEKVKAENGFQDNYSVVVASGLKSQSKRAVSATPPRPPSRRGRTV
PDKIGTTSSGAETANKIITVPVFHLFHKLLAGQPLPAEMTLAQLLTLLYDRKLPQGYRSI
DLTVKLGSRVITDPSLSKTDSFKRLHPEKDHGDLLGSCPEDEALTPSDECMDGILDESLL
ETCPIQSPLQVFAGMGGLALIAERLPMLYPEVIQQVSAPVVTSTTQEKPKDSDQFEWVTI
EQSGELVYEAPETIAAEPPPIKSSVQTMSPIPAHSLAAFGLFLRLPGYAEVLLKERKHAQ
CLLRLVLGVTDDGEGSHILQSPSANVLPTLPFHVLRSLFSATPLTTDDGVLLRRMALEIG
ALHLILVCLSALSHHAPRVPNSNLNQAEPQVSSSHNPASTEEQQLYWAKGTGFGTGSTAS
GWDVEQALTKQRLEEEHVTCLLQVLASYINPVSGTVNGDAQSSQESRGQNSSALPSVLLE
LLSQSCLIPAMSSYLRNDSVLDMARHVPLYRALLELLRAIASCTSMVPLLLPLSTENGEE
EDEQSECQTSVGTLLAKMKTCVDTYTNRLRSKRENVKTGVKPDASDQEPEGLTLLVPDIQ
KTAEIVSAATTSLRQANQEKKLGEHSKKVAMKPKPLSVLKSLEEKYVAVMKKLQFDTFEM
VSEDEDGKLGFKVNYHYMSQVKNASDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCD
EERLDIMKVLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYND
GKVCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQ
SSREYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHFYLKRVEIMAQCEEWIADIQQYSS
DKRVGRTMSHHAAALKRHTAQLREELLKLPCPEGLDPAAAEAEVCRDAADAEETLTRSQG
PAGGSGSSSELPGDFQL
NT seq 14634 nt   +upstreamnt  +downstreamnt
atggtgactggtggtggtgctgcacctcccgggactgtcactgagccgcttcccagtgtg
attgtgcagagcgcaggccggaagatggcggctgcggctgcggcggcctcgggcccgggc
tgctcctcggtggcggcggcggcgggggcgggagcgggagcggccggggtctcagagtgg
ctggtgctgcgggacggctgcatgcgctgcgacgccgacgggctgcacagcctctcctac
cacccggcgctcaacgccatcctggccgtcaccagccgcgggaccatcaaagtcatcgac
ggcacctcgggggccaccctgcaggcctcggcgctcagcgctaaaccaggaggacaggtg
aaatgtcaatatatttctgctgtggataaagttgtgtttgtggatgattatgcagtaggc
tgtaggaaagacctcaatggaatcttgttgttagacactgctctgcagactccagttgca
aagcaggatgatgtggttcagcttgaattaccagttacggaggcacagcagctcttatca
gcatgtttagaaaaggtagatatttctagtacggagggttacgatttgttcatcacacag
ctcaaagatggtttaaaaaatacatctcatgagactgcagcaaaccacaaagttgctaag
tgggccacagttacatttcatcttcctcatcatgtattgaagtccattgccagtgccatt
gtaaatgaactcaagaaaataaatcaaaatgttgctgccttacctgtggcgtcctcagtg
atggacagattgtcttacctcttacctagtgcacgtccagaacttggagtggggccaggc
cgttctgtagacagatcattgatgtatagtgaagctaatagacgggagacatttacctca
tggcctcatgtaggctacaggtgggcacagccagatcccatggctcaagctggattttat
catcagcctgcctcgtctggagatgatagagccatgtgttttacttgtagtgtgtgcctc
gtttgttgggaacctacagatgaaccttggtctgaacatgagagacattccccaaactgc
ccctttgtgaagggtgaacacacgcagaatgtgccattgtcggtcactcttgcaacaagt
cctgcgcagtttccttgtacagatggaactgacagaatatcttgctttgggtcagggagc
tgccctcagtttttagctgctgcaactaaacgaggaaagatttgcatatgggatgtttcc
aagcttatgaaggtgcacttaaagtttgaaattaatgcctatgatccagcaattgtacag
caacttattctatcaggagaaccaagctcaggagttgattcaaggagaccaactttggcg
tggctggaggattcctctagttgctcagacatacccaaattggaaggagatagtgatgat
ttactggaggattcagacagtgaagagcattccagatcagattctgtgacagggcataca
tcacaaaaggaagccatggaaataagcctggatgtaacagcactcagcattctccaacaa
ccagaaaaacttcagtgggagattgttgcaaatgtgcttgaagatactgttaaggatctt
gaagaacttggggcaaatccttgcttaacaaactctaagaatgagaagacaaaagaaaag
caccaggaacaacacaacattccctttccgtgtttgttggcaggaggtttattaacatac
aaatctcctgctacttcccctattagtagtaattctcacaggtcactggatggtttaagc
agaactcagggtgaaagtatatcagagcaagggtcaactgacaatgaatcctgcactaat
tcagaactcaattctcctctggtaaggaggactttgcctgttttacttctttatagcatc
aaggaatctgatgagaaagcaggaaaaatcttttcacagatgaacaatattatgagtaaa
agtttgcatgatgatggctttactgttccccagatcattgagatggaactggacagtcag
gagcagctgttgttgcaggacccccctgtgacttacattcagcagtttgcagatgcagca
gctggccttgcgtctccagattctgagaagtggaactctgtgtttcctaagccggggact
ctggttcagtgcttgcggctgccaaagtttgcagaggaggagaatctttgtgtagactca
ataactccctgtgctgatggaatccatttgttggtagggctgcggacatgccctgttgaa
tccttgagtgcaataaatcaagtagaggccttgaataatttaaataaattaaactctgca
ctatgtagtagacggaaaggtgagctggaatcaaatctcgctgtagtgaatggtgcgaac
cttagtgtcatccaacatgaatcaccagcagatgtacagactcctttgatcattcagcct
gagcagaggaatgttagtggtggatacttagtgctttataaaatgaattatgccactcgg
atagtgactttagaagaagagcccataaaaatccaacatatcaaagatccccaggacaca
attacctcgctcattttgcttccaccagatatattggataatcgagaggatgactatgag
gaacctgctgaagaaatgcagttaacctcaaagaatggcattgagagagaaagaaagtct
gacatttccactcttggacacctggtaataaccactcagggaggatatgtaaaaatacta
gatctttcaaactttgaaattttggccaaagtggaacctcctaaaaaggagggcactgag
gaacaggacacatttgtttctgtcatttactgctccggcacagataggttgtgtgcatgc
accaaaggtggtgagcttcattttctccaaattggaggcacctgtgatgatattgatgaa
gctgatattctagtggatggatctctttccaaaggaatagaaccatcttcagaaggttct
aaacctttgtcaaatccttcaagtcctggcatttcaggagttgatttgttggtggaccag
cctttcactcttgaaatcttgacgtctctagtggagctaacccgctttgagactctgact
ccacggttttcagctactgttcctccatgctgggttgaagttcagcaagaacagcagcaa
aggaggcatcctcagcatttgcatcagcaacaccatggagatgctgctcagcatactaga
acttggaaactgcagactgacggtaacagctgggatgaacatgtatttgaattggttcta
cctaaagcttgtatggttggacatgtggacttcaaatttgttttgaactcaaacatcact
aatattccacagatacaagtgacattgctgaaaaacaaagctccaggcttagggaaagtt
aatgctcttaacattgaagtggaacaaaatgggaaaccgtccctggttgatttgaatgaa
gaaatgcagcacatggatgtagaggaatcacagtgtcttaggttatgtccatttttagag
gatcacaaagaagatattctgtgtgggccagtgtggcttgctagtggccttgatctatca
gggcatgccgggatgttgacgttaacaagtcccaaacttgttaaaggtatggcaggagga
aaatatcgctcatttttaatccatgtcaaggcagtgaatgaaagaggaacagatgacatt
tgtaatggtggtgtacgtcctgttgtgagacttccatccctgaaacaccagagtactaag
ggttactcactggcttccctcttggctaaagttgcagcaggaaaggaaaaatcatcgaat
gtcaagaatgagaatgcaagtggtactcgtaaatctgaaaacctccggggctgtgattta
cttcaagaggtctcagtcaccattagaagattcaagaaaacttcaatctctaaagaaaga
gtgcaacgatgtgccatgttacagttttcagaatttcatgagaagcttcttaacactctt
tgcagaaaagtagatgatggtcaaatcacagaacatgcccagagccttgtgttggatact
ctttgttggttagctggagtacattcaaatggacctggaagctcaaaagaaggaaatgag
agcttactttcaaaaacacgaaaatgtctttcagatattgtacgtgtttgcttctttgag
gcaggacgaagtattgctcataagtgtgcccgatttctagccttgtgcattagtaatggc
aaatgtgacccatgtcagccaggatttggatctgttcttttgaaggctttacttgataac
atggcatttttgcctgcagcagcaactggaggttctgtctattggtattttgtcctgttg
aattatgttaaagatgaagatttggctgggtgcagtacagcttgtgcatctttgcttact
gctgtgtccagacagttacaggacaggctaacgccaatggaggccttacttcaaacaaga
tatgggttatatagctcgccatttgatccggtcctctttgatttggagatgagtggctct
tcctgtaaaaatgtatacaacagcagcattggtgtccagtcagacgaaattgatttgtca
gatgtcctttcagggagcggaaaggtcagcagttgcacggctgctgagggtagtttcaca
tctctcactggactcctggaagttgaaccactgcactttacttgtgtgtccactagtgac
ggaacccgaatagaaagggatgatgcaatgagttccttcggggttactcctgcagtaggt
ggactatcatctgggacagttggggaagcctcgacagccctgagttcagcagcccaggta
gctttgcagtctctctctcatgcaatggcttcagccgagcaacagctgcaggtgctgcaa
gagaaacagcagcagcttttgaagcttcagcaacagaaagcaaagctggaagccaagtta
catcagacaacagctgcagcagctgcagcagcgtcagcagcatcagcagtaggtcctgtt
cacaactctgtgccttccaacccagtggctgcccctggattcttcattcatccatctgat
gttattccacccactccaaaaacaacaccactttttatgactccaccactcactccaccc
aatgaagcagtgtccgttgtgattaatgccgaacttgcacaacttttcccaggctcagtc
attgatcccccaacagtcaatcttgctgcacataacaaaaattccaacaagtccagaatg
aatcctcttggttctggtctagcccttgcaatttctcacgcatcacattttcttcagcct
ccacctcaccagtccatcattatagagcgaatgcattcaggagcaaggagatttgtgact
ttagattttggcaaatcaatactgttgacagatgtgttgattccaacttgtggtgacttg
gcttctttgtcaattgacatttggacattaggagaagagatggatggaaggcggttggta
gtggccactgatataagtactcattcactaattcttcatgacttaataccacctcctgtg
tgcagattcatgaagatcactgtcattggacgttacggcagtaccaatgcaagagccaaa
attcctttaggattttactatggtcatacgtatatcttgccttgggaaagtgaactgaaa
ttaatgcatgatcctctaaggggagaaggagaatctgcaaaccagccagaaattgatcag
catttaacgatgatggttgctctacaggaggatatacaatgccggtacaacttggcttgt
catcgtctagaagctcttttgcaaagtattgaccttcctcctcttaacagtgctaataat
gcacaatactttttgcgaaaaccagacaaggcagtggaggaagacagtagggttttttct
gcttatcaagattgtattcagctacagcttcaactaaatttggctcataatgcagtacag
aggctcaaagtggctctcggttcaagtcggaagatgttgagtgaaacatcagatccagaa
gatttaattcagatgtcttccacagagcagttacgtaccatcatcagatatctgctggac
actttgctcagcctacttcactcctccagtggacactctgttcctgcagttttgcagagc
acgttccatgcccaggcctgtgaagagctctttaaacacttgtgcattagtggaacccca
aagatacggttacacactggtcttctgcttgtgcagctatgtggtggtgaaagatggtgg
ggtcagtttctttctaatgttcttcaggaattgtacaattcagagcagcttctcatcttt
ccacaggatagagtcttcatgttactttcctgcattggtcagagatcacttagtaatagt
ggagtattagaaagcttactgaatcttctggataatttattgtcacctcttcagccacag
ttacccatgcataggcggacagaaggagtactagatattcccatgatcagttgggttgtt
atgctggtgtccaggttgctggattatgtggcaactgttgaagatgaagcagcagctgca
aagaaacctttgaatggtaaagacagggagagatttctgacaggtaaccagtggagtttt
attaacaataatctacatactcagagtttaacaagatcttcgaaaggcagcagtagcctt
gatagattatattctaggaaaatcagaaagcagcttgttcatcataaacagcaacttaac
ctattaaaagcaaaacagaaggctttggtggagcagatggaaaaagaaaaaatacagagc
aacaaaggatcctcatataaactcctggtagagcaagcaaaactgaaacaggctacttca
aagcactttaaggatttaattcgtttacgacggacagcagaatggtctcgttctaattta
gacacagaagttacaactacaaaagaaagtccagagatagaacctcttccatttactctg
gcacatgaacgttgtatctcagttgtccagaaacttgttctgtttctcctgtccatggat
tttacatgtcatgcagatctcttactatttgtttgtaaggttcttgcacgcattgcaaat
gctacaaggccaactattcatctgtgtgagattgtcaatgaaccgcaactggagagactg
ctgttacttctggttgggactgacttcaacagaggagatatatcatggggtggtgcttgg
gctcagtactccttaacttgtatgctgcaagatattttagcaggagaattgttggctcca
gtagctgcagaagccatggaggaaggaacagtgagtgatgatgttggtgcaacagctggg
gactctgatgactctcttcagcagtctgcggttcagttgctggaaactattgatgagcct
ttgacacacgatataacaggtgcacctcccctctcctctttggaaaaagataaagaaatt
gacctggagttacttcaagatctaatggaagttgatattgatcctttagatattgattta
gaaaaggatcctcttgcagccaaagtttttaagccaataagcagtacgtggtatgattac
tggggtgctgattatggcacgtacaattacaacccttacattggcggtctgggaattcct
gtagcaaagccaccagcaaacacagagaagaatggatcacagactgttagtgtttcagtg
tctcaggccctagatgctcgccttgaagttggtcttgaacagcaggcagaacttatgttg
aaaatgatgtcaactctggaagcagattccattttacaggcactaacaaatacatctcct
acattgtcacagtctcccactggaacagatgattcacttctaggcggttttcaggcagtg
aaccaaaccagccaacttattatccagttatcttctgtcccgatgttaaatgtttgtttc
aacaaacttttttccatgcttcaagtccatcatgttcagttggaatcacttctccagttg
tggctcacattgagcctgaattctagttcatctggaaataaggagaatggagctgacatt
tttttatataatgctaatcgagtacctatcatttcattaaatcaagcgtcaataactagc
tttctcacagtgctagcttggtatcccaatactttgcttcggacatggtgcctcgtgctt
catagcttaacactcatgacaaacatgcagcttaactctggatgcagtaatgctattgga
actcaggaaagtactgcacatctgttggtttcagatccaaaccttattcatgtgttagta
aaatttctttctggcaccagtccacatggaacaaatcaacacagtccacaggttggtcca
acagctacacaagctatgcaagaatttcttacccgattacaagttcatctttcttcaaca
tgtcctcaaatattcagtgaatttttgcttaaattagttcacatactttcaacagaaagg
ggtgctttccagacaggtcaaggacctcttgatgcccaagtgaagcttttagaatttact
ttggagcagaattttgaagttgtttcagttagtactatttctgctgtgattgaatctgtc
acttttttagtacaccactatatcacttgctcggacaaagtaatgtctagaagtggatcg
gatagctctgtgggtgctcgggcatgctttggtggactctttgccaatcttatccgtcca
ggtgatgcaaaggcagtttgtggtgaaatgacaagagaccaacttatgtttgatttgtta
aaacttgtgaacattttagtacagttgcctctttcaggaaatagggaatacagtgcaaga
gtgtctgtgaccagcaatacaacagatagtgtatcagatgaagaaaaagtctcaggaggc
aaagatgtcaatggaagcagtaccagtactcaaggatctcctgcctatgttgctgactta
gtcttagccaaccaacaaattatgagccagattttgtctgctctgggcctgtgtaacagc
agtgccatggcaatgataattggggcaagtggactacatctcaccaagcatgagaacttc
catggtgggttagacgctatttcagttggggacggattgttttccatactgacaaccctt
agcaaaaaagcttctacagtccacatgatgctgcagccaattttaacatacatggcctgt
ggatatatgggcagacaaggctctcttgctacctgccagttatcggaaccattattgtgg
ttcattttaagagtgctggatactagtgatgcgttaaaagcattccacgatatgggtggt
gttcaactaatttgtaacaacatggttactagtacaagggccattgtgaacactgcaaga
agtatggtatcaactattatgaaatttcttgattctggcccgaataaagctgttgacagc
actttaaaaacaagaatcctggcttctgagcctgataatgcagaaggaatccataacttt
gcacctctgggtacaatcacatccagcagtcctaccgctcaacctgcagaagtgcttttg
caggctactccaccccatagacgagctcgctctgctgcttggtcctacatctttctgcca
gaggaagcatggtgtgatctcaccattcacttgcctgcagcagtgcttcttaaagagata
catatccaacctcacttggcatcccttgcaacctgcccatcctcagtgtctgttgaagta
agtgcagatggggtaaatatgctacccttgtctacgcctgttgtcacaagtggtctcacc
tacataaaaattcagcttgtaaaagctgaagtggcttctgccgtctgtcttagactgcac
cgtcctcgagatgccagtacattgggcctttcacagatcaagttgttgggccttactgcc
tttggtaccacttcttcagcaacagttaataaccccttccttccgtctgaagatcaggta
tccaaaacaagcattggatggttacggttattacatcattgccttactcacataagtgat
ctggaaggaatgatggccagtgcagctgcacctactgctaatctgctacagacttgtgct
gccttactgatgtcaccgtactgtggaatgcattcacccaacattgaagttgtgctcgtc
aaaattgggctgcagtccactagaattggcttgaagcttatagacattctcttgagaaat
tgtgctgcatcaggcagtgatcctacagatttgaatagccctttactttttggaagactg
aatggactctcttctgactctacgatagatattctttaccagcttggaacaactcaggat
cctggaacaaaagacagaattcaggccttgttaaaatgggtcagtgattctgcaaaagtg
gctgctatgaagagaagtggcaggatgaactacatgtgccctaattattcagcaatagag
tatggtcttctgatgccatctccttcgcatttacattgtgtagcagcgattctgtggcac
agttatgaactgcttgtagagtatgatttaccagccttgctagacagagagctctttgag
ttgctttttaattggtccatgtctcttccctgcaacatggttctgaagaaagctgttgac
agtctgctttgctccatgtgtcacatccaccccagctacttttctttgctcatgggctgg
atgggcatcacacctcctccagtgcagtgtcacaacagactttccatgacagacgatagc
aaaaagcaggatctcagttcatctctaacagatgactctaaaaatgctcaagcaccattg
acgctaactgaatcgcatttggcgacccttgcttcctcttctcagtctccagaagctatc
aaacagctactagactcaggtttgccttctttacttgtgaggagtctggctagtttctgc
ttcagccacatttcttactcagaaaacatcgcccagtcaatagatgtttcccaggacaaa
ctcaggcggcatcacgttccacagcagtgcagtaagatgcccatcacagctgacctggtc
gctcctgttctgaggtttttgacagaagttggcaatagccatataatgaaagattggctt
ggagggtctgaagtcaatcccctctggacagcacttctgtttttattgtgccaccctggc
tcggcttctggagctcataatttaggtgcgcaacagaccagtgtaagatcaacctccctt
tcttcagctgctaccacagggttgactactcaacaacggacagcaatcgagaatgcaact
gttgcattctttctccagtgcatctcatgccaccctaataatcaaaagctgatggcacag
gttctttgtgaactatttcagacagctcctcagcgagggaaccttccaacatctgggaac
atttcagggtttatccgcagattgtttttacagttgatgctagaagatgagaaagtgaca
atgtttcttcagtctccctgcccgctgtacaaaggtagaattaatgccactagccatgtc
atccagcatccaatgtatggagcaggccacaagttccgcactcttcatttgccagtctca
acaacattatcagatgtccttgacagagtgtcagatactccgagtatcacagctaaacta
attagtgaacaaaaagatgacaaagaaaagaaaaaccatgaagaaaaagaaaaagttaag
gcggaaaatggatttcaggacaactatagtgttgttgttgcttctgggctgaagtctcag
tctaaacgtgctgtgtctgctaccccacctcgaccaccttccaggcgggggaggacagta
cctgataaaataggaactacttcctcaggagcagagactgccaacaaaatcattactgtc
ccagtatttcatctatttcacaaactcttggcaggccagccgttgccagctgaaatgaca
cttgcccagcttttaactctcctgtatgaccgaaaactgcctcagggttatcgctcaata
gatctgactgttaaattgggatcaagggttatcacagacccaagcctgtcaaaaacagat
tcttttaaaagactgcaccctgaaaaagatcatggagatttacttggtagctgtccagaa
gatgaggccctcactccaagcgatgagtgcatggatggcatattggatgaatctttactt
gaaacctgtcccattcagtcaccattacaagtttttgcaggaatgggtggactggctctt
attgcagaaagattacccatgctatatccagaagtaattcagcaggtcagtgctccagtt
gtaacatccaccactcaggaaaagccaaaggatagtgatcagtttgaatgggtgactatt
gagcagtctggggagttagtgtatgaagcaccagaaaccattgcggctgagcctcctccg
atcaagtcatcagtccagaccatgtctcccatacctgctcactctctagctgcttttgga
ttattccttcgtcttccaggctatgctgaagtgctactgaaagagagaaaacatgcccag
tgccttcttcgattggtactaggagtgacagatgatggagaaggaagtcacatactacaa
tctccatcagccaatgtgcttccgacccttcctttccatgtcctccgtagcttgtttagc
gctacacctctaacaactgatgacggtgtgcttctaagacggatggccctggaaattggg
gcgctacacctcattcttgtctgtctctctgctttgagccaccatgccccacgagttcca
aactcaaacctcaatcaagcagagccacaggtgtcaagctctcataaccctgcgtcaaca
gaagaacagcagttatactgggccaaagggactggttttggaacaggctccacagcttca
ggatgggatgtggaacaggccttaactaaacagaggctggaagaggaacatgttacctgt
cttctgcaggttcttgcaagttacataaaccctgttagtggtacagtaaatggagatgct
cagtcctctcaggagagcagaggccagaacagtagtgccctgccttcggtactgctggag
ctgcttagtcagtcctgcctcatcccagccatgtcatcttatctacgaaatgactcagta
ctggacatggcaagacatgtgccactctatcgagctctgctggaattgctccgtgccatt
gcttcttgtacatccatggtgccgctcttactgcctctttctacagagaatggcgaagag
gaagatgaacagtcagagtgtcaaacttctgttggtacattattagccaaaatgaagact
tgtgttgatacctacaccaaccgtttaagatctaaaagggaaaatgttaaaacaggagta
aaaccagatgcatctgatcaagaaccagaaggacttactcttttggtgccagacatccaa
aagactgctgagatagtttctgctgccaccaccagtttgcgacaggccaatcaagaaaag
aaactaggtgaacactccaagaaggtggctatgaaacccaagcctttgtcagtgttaaaa
tctcttgaagaaaaatatgtggctgttatgaagaaattacagtttgatacatttgaaatg
gtttctgaagatgaagatgggaaattgggttttaaagtaaattaccactacatgtctcag
gtgaagaatgccagtgacgcgaacagtgctgccagagcccgtcgccttgcccaggaagct
gtgacgctttctacctccctgcctctgtcgtcatcctccagtgtgtttgtacgctgtgat
gaggagcggctcgacatcatgaaggttctgataactggcccagcggataccccctatgca
aatggctgctttgagtttgatgtatattttcctcaagattatcccagctcaccccctctt
gtgaatctagagacaactggtggtcatagtgtacgattcaatccaaacctctataatgat
ggcaaggtttgtttaagcatcttaaatacttggcatggaaggccagaagagaagtggaat
cctcagacctcaagctttttgcaagtgttggtatctgtgcagtcccttatattggtagct
gagccttatttcaatgagccaggatacgagcgttctcgaggcactcccagtggcacgcag
agttctcgagagtacgatggaaacattcgacaggcgacagttaaatgggcaatgttagaa
caaatcagaaacccttcaccatgttttaaagaggtcatacacaagcatttttacttgaaa
agagttgagatcatggcgcagtgtgaggagtggattgcagacatccagcagtacagcagt
gataaacgcgtcggcaggaccatgtcgcaccacgcagctgctctcaagcggcacacggca
cagcttcgggaggagctgctgaagctcccctgccctgaaggcttggaccccgccgccgcc
gaggctgaggtgtgcagggacgcggccgatgctgaggagacgctgacgcgcagtcagggc
cccgccggcggcagcggcagcagcagcgagctcccgggagacttccagctatga

DBGET integrated database retrieval system