KEGG   Oryctolagus cuniculus (rabbit): 100342491
Entry
100342491         CDS       T03373                                 
Symbol
OSM
Name
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100342491 (OSM)
   04151 PI3K-Akt signaling pathway
    100342491 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342491 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100342491 (OSM)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  CSF and other factors
   100342491 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 100342491
NCBI-ProteinID: XP_008272926
Ensembl: ENSOCUG00000010199
UniProt: U3KMW4
LinkDB
Position
Un
AA seq 247 aa
MRARLTWRSLFSVVLGLLLLSTTARCSCSRRYPELLDQLRNQADLLQNPESLLIPYIQYQ
GLEVPGPSEPCTEHPRDFPSEAALQRLSRRGFLWTLNATIDHVLPRLETMKKELFAPTDL
EQLQATANNLLGLRSNLYCMTRLLQGSSEPAKPTQSGSEPSPPPPPPPPPPPPTRSQHVF
QAKQENCRFLCGYHRFMRSARRVFSEWPHSLNPSPTHSPPEDLPKQIPGIRPSRRTKRPK
LRGKLLL
NT seq 744 nt   +upstreamnt  +downstreamnt
atgcgggcacggctcacatggaggtcgctgttcagtgtggtccttggactcttgcttctg
agtaccacggccaggtgcagctgctcgcgccggtacccggagctcctggaccagctgcgg
aaccaggcggacctcctgcagaaccctgagagcctgctgatcccctacatccagtaccaa
ggcctggaggtgccggggccgagtgaaccctgcacggagcaccccagggacttccccagt
gaggctgccctgcagcggctgagcaggcgcggtttcctgtggaccctcaacgccacgata
gaccacgtcctgcccagactggagaccatgaagaaggaactgttcgcgcccacggacttg
gagcagctgcaggccaccgccaacaacctcctggggctcaggagcaacctctactgcatg
acccggctgcttcagggctcctcggagccggccaagcccacccagtctggctccgagccc
tcgccgccgccgccgccgccgccgccgccgccaccgcccacccgctcccagcacgtcttc
caagctaagcaggagaactgcaggttcctgtgtggctaccaccgcttcatgcgctccgcg
cgccgggtcttcagcgagtggccgcacagcctgaacccgagcccgacacacagccccccc
gaggacctgccgaagcagatccctggcatccgaccctccaggaggaccaagagaccaaag
ctcagggggaaactgctcctgtag

DBGET integrated database retrieval system