KEGG   Oryctolagus cuniculus (rabbit): 100342561
Entry
100342561         CDS       T03373                                 
Symbol
TFRC
Name
(RefSeq) transferrin receptor
  KO
K06503  transferrin receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04066  HIF-1 signaling pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04216  Ferroptosis
ocu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100342561 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100342561 (TFRC)
   04145 Phagosome
    100342561 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    100342561 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100342561 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100342561 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100342561 (TFRC)
   04090 CD molecules [BR:ocu04090]
    100342561 (TFRC)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   100342561 (TFRC)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100342561 (TFRC)
  Exosomal proteins of colorectal cancer cells
   100342561 (TFRC)
CD molecules [BR:ocu04090]
 Proteins
  100342561 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 PA TFR_dimer Uso1_p115_head
Other DBs
NCBI-GeneID: 100342561
NCBI-ProteinID: XP_002716583
Ensembl: ENSOCUG00000017033
UniProt: G1TCW1
LinkDB
Position
14:92652686..92675981
AA seq 763 aa
MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENVENNVRANVAKPK
RCNGTLCYAMVAIIIFFLIGFMIGYLGNCKRVEQKAECESVAGTEVEQSENAEPEEDLPV
IPPRLYWEDLRTMLSEKLDTTDFTSTIRQLNENSYIPREAGSQNDENLASFVENKFRDFK
LSKVWHDEHFVKIQVKDSAQNSVIIVNKNSEAPDLVENPMGYVAYSKATTVTGKLIHANF
GTKKDFEDLNSPVNGSIVIVRAGEITFAEKVANAESLNAIGMLIYMDQMKFPIVKADLPL
FGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISREAAEKLFGNMEGACPSEW
QTDSTCRLQSSQNKNVKLTVNNVLKEARILNVFGVIKGFEEPDRYIVVGAQRDAWGPGAA
KSSVGTALLLELARMFSDMVLKGGFKPSRSIIFASWSAGDFGAIGATEWLEGYLSSLHLK
AFTYINLDKAVLGTTNFKVSASPLLYKLIEKTMQDVKHPVTGMSLYQDSNWVNKVEKLSF
DNAAFPFLADSGIPSLSFWFCEDTDYPYLGTTFDTYGMLIQKIPQLNKMARAAAEVAGQF
MIKLTHDAELNLDYEMYNNKILSFVRELNQYRAYIKELGLNLQWLYSARGDFFRATSRLT
TDFKNAEITNRFVMREINDRIMKVEYHFLSPYVSPRESPFRHIFWGSGSHTLSALLENLN
LRQKNNGAFNETLLRNQLALATWTIQGAANALSGDIWDIDNEF
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattttctaatttgtttggtggagaaccactgtcatat
acccggttcagcctggctcgacaagtagatggtgataacagtcacgtggagatgaagctg
gctgtggatgaagaagaaaacgttgagaataacgtgagagccaatgtcgcgaaaccaaaa
aggtgcaacggaactctctgctacgcgatggttgctataatcatttttttcttgattgga
tttatgattggttacttgggaaattgtaaacgtgtagaacaaaaagctgagtgtgagagc
gtggcaggaacagaagtggagcagtcagaaaacgcggagcccgaagaggacttgcctgta
ataccccctcggttgtactgggaagacctcagaacaatgttgtcagagaaactggatacc
accgatttcaccagcaccatcaggcaactgaatgagaattcttatatccctcgtgaggct
ggatctcagaatgatgaaaatcttgcatcttttgttgaaaataaattccgtgactttaaa
cttagtaaagtctggcacgatgaacattttgttaagattcaggtcaaagacagtgcacag
aactcagtgatcatagtgaataagaacagtgaggcgcccgacctggtggagaatcctatg
ggttatgtggcatatagtaaggctaccacagttactggcaaactgattcatgccaatttt
ggcactaaaaaagactttgaggacttaaactctcccgtgaatggatcgatagtgattgtt
agagcaggggagattacttttgcggaaaaggttgctaatgctgaaagtttaaatgcaatt
ggtatgttgatatacatggaccagatgaagtttcccattgttaaggcagaccttccactc
tttggacatgctcatctgggaacaggtgacccttacacacctgggtttccttctttcaat
cacactcagtttccaccatctcagtcatcaggattgcctaatatacctgtccagacgatt
tccagagaggctgcagagaaactgtttggaaacatggaaggagcctgtccttctgagtgg
caaacagactctacatgtaggctccagtcctcccagaacaagaatgtgaagctcactgtg
aacaacgtgctgaaagaggcgagaattctgaacgtctttggcgtcattaaaggctttgaa
gaaccagaccgctatattgtagtaggggcccagagggatgcctggggtcctggagctgca
aagtccagtgtaggaacagctcttctattggaacttgcccggatgttctcagacatggtc
ttaaaaggtggatttaaacccagccgaagcattatctttgcaagctggagtgctggagac
tttggagctattggtgccactgaatggctagagggatacctttcatctttgcatttaaag
gctttcacttacattaatctggataaagctgttcttggcaccacaaacttcaaggtttct
gccagcccactgttgtataagcttattgagaaaacgatgcaagatgtgaagcatccagtt
actgggatgtctctatatcaggatagcaactgggtcaacaaagttgagaaactttctttt
gataatgctgctttccctttccttgctgattctggaatcccgtcactttctttctggttt
tgtgaggacacagattatccttatttgggtactacctttgatacctatgggatgctgatt
cagaagattccacagttgaacaaaatggcccgggcagcagcggaagtggctggtcaattc
atgattaaacttactcatgatgctgagttgaacctggattatgagatgtataacaacaaa
atactctcctttgtgagggaactgaaccaatacagagcatacataaaggagctgggcctg
aatctacagtggctatattctgctcgtggagactttttccgtgctacttctagattgaca
acggatttcaaaaatgcagaaataaccaacagatttgtcatgagggaaatcaatgaccgc
atcatgaaagtggaatatcacttcctgtcaccctacgtgtctccgagagagtctcctttc
cgacacatcttctggggctctggctctcacactctgtcggctttgctagagaacctgaat
ctgcgtcagaaaaataacggtgcttttaatgaaacactgctgagaaaccagttggcgcta
gctacttggactattcagggagctgccaatgccctctctggtgacatctgggatattgac
aatgaattttaa

DBGET integrated database retrieval system