KEGG   Oryctolagus cuniculus (rabbit): 100342639
Entry
100342639         CDS       T03373                                 

Symbol
PIM1
Name
(RefSeq) Pim-1 proto-oncogene, serine/threonine kinase
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100342639 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342639 (PIM1)
   05206 MicroRNAs in cancer
    100342639 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100342639 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100342639 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100342639 (PIM1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100342639 (PIM1)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   100342639 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH FTA2 TCAD9 Choline_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 100342639
NCBI-ProteinID: XP_017200571
Ensembl: ENSOCUG00000012028
UniProt: G1T2G8
LinkDB
Position
12
AA seq 313 aa
MLLSKINSLAHLRAAPCSDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPIGTRVPMEVVLLKKVSSGFRGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFRQVLEAVRHCHSCGVLHRDIKDENILIDLSRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPSFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgctggcccacctgcgcgccgcgccctgcagcgacctg
cacgccaccaagctggcgcccggcaaagagaaggagcccctggagtcgcagtaccaggtg
ggcccgctgctgggcagcggcggcttcggctcggtgtactcgggcatccgcgtcgccgac
aacttgccggtagccatcaaacacgtggagaaggaccggatttccgactggggcgagctg
cccatcggcacccgcgtgcccatggaggtggtcttgctgaagaaggtgagctcgggcttc
cggggcgtgatccggctgctggactggttcgagaggcccgacagcttcgtgttgatcctg
gagcggcccgagccggtgcaggacctcttcgacttcatcacggagcggggggccctgcag
gaggagctggcgcgcagcttcttccggcaggtgctggaggccgtgcggcactgccacagc
tgcggggtgctgcaccgtgacatcaaggacgagaacatcctcatcgacctcagccgcggc
gagctcaagctcatcgacttcggctcgggcgcgctgctcaaggacacggtctacaccgac
ttcgacgggacccgggtgtatagccctcccgagtggatccgctaccatcgctaccacggc
cggtcggcagccgtctggtccctggggatcctgctctacgacatggtgtgcggggatatt
cctttcgaacacgacgaggagatcatcaggggccaggtcttcttcaggcagagggtctct
tcagagtgtcagcatctcatcagatggtgcttggccctgcgaccatcggatcggccatcc
ttcgaagaaatccagaaccacccgtggatgcaggacgtcctcctgccccaggagactgct
gagatccaccttcacagcctgtcgccagggcccagcaaatag

DBGET integrated database retrieval system