KEGG   Oryctolagus cuniculus (rabbit): 100342652
Entry
100342652         CDS       T03373                                 
Symbol
NODAL
Name
(RefSeq) nodal growth differentiation factor
  KO
K04666  nodal
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100342652 (NODAL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342652 (NODAL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100342652 (NODAL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100342652 (NODAL)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100342652 (NODAL)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 100342652
NCBI-ProteinID: XP_002718481
Ensembl: ENSOCUG00000008685
LinkDB
Position
18:16532482..16540118
AA seq 356 aa
MHAHRLAFLLLHACWTLLQVDAATMATVPLRTRRQSSSPSPLAYMLSLYRDPLPRADIIR
SLQAQDVEVAGRNWTFAFDFSFLSQEEELAWAELRLQPSGPEDLPAEGPLTIEIFHQPKA
DTEQDPADCLERLRMEVFTVALSQVTFSSGSMVLEVTRPLSKWLKHPRALEEQVSSLAGA
CWRLPPTPPGTLPGTDSVPTVVLVLHSNLSQEQRRLGGSTLLWEAESSWRAQEGQLDSER
GRRHRRHQLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPT
NHAYIQSLLKRYHPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgcacgcccaccgtcttgcgttcctcctactgcacgcctgctggaccctgctccaggtg
gacgccgcgacgatggccaccgtgcccctacgtacgcggaggcagtcctcgtcaccgtcc
cctcttgcatacatgctgagcctctaccgcgaccctctgccccgcgcggacatcatccgc
agcctgcaggcgcaagacgtggaggtggctgggcggaactggacctttgcttttgacttc
tccttcctgagccaagaagaagagctggcgtgggctgagctccggctgcagccgtctggc
cccgaggacctgcccgccgagggcccgctcaccattgagatcttccaccagcccaaggca
gacacagagcaggacccggccgactgcttggagcgtctccggatggaggtgttcaccgtc
gctctgtcccaggtcaccttctcctcaggcagcatggtcctggaggtgaccaggccactc
tccaagtggctgaagcaccccagggcactggaggagcaggtgtccagtctggccggagcg
tgctggcggctaccccctactccacctggcaccctgcccggcaccgactctgtccccacc
gtggtcctcgtgctccactccaacctctcccaggagcagaggcggctgggcggctccacc
ttgctgtgggaagccgagagctcctggcgggcccaggaggggcagctggactccgagagg
ggcaggaggcaccggcggcatcagttgccagacagaagccaactgtgccgcaaggtcaag
ttccaggtggacttcaacctcatcggctggggctcttggatcatctaccccaagcagtac
aacgcctaccgctgtgagggcgagtgtcctaaccccgtgggagaggaatttcatccgacc
aaccacgcctacatccagagcctcctgaagcgctaccaccctcaccgagtcccttccacc
tgctgcgccccggtgaagaccaagccgctgagcatgctctacgtggacaacggcagggtg
ctgctggaccaccacaaggacatgattgtggaggagtgcggctgcctttga

DBGET integrated database retrieval system