KEGG   Oryctolagus cuniculus (rabbit): 100342658
Entry
100342658         CDS       T03373                                 
Symbol
HUWE1
Name
(RefSeq) HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase
  KO
K10592  E3 ubiquitin-protein ligase HUWE1 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342658 (HUWE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342658 (HUWE1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100342658 (HUWE1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100342658 (HUWE1)
SSDB
Motif
Pfam: DUF913 HECT UBM DUF908 WWE UBA
Other DBs
NCBI-GeneID: 100342658
NCBI-ProteinID: XP_017205217
Ensembl: ENSOCUG00000007354
LinkDB
Position
X:complement(35019847..35157049)
AA seq 4470 aa
MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLA
ECCRDLHMMKYPPSATTLHFEFYADPGAEVKIEKKTTSNTLHYIHIEQLDKISESPSEIM
ESLTKMYSIPKDKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPSMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPSTTQEGEEMETDMDVADVTMESSPGSSISMEQRLDVELRTSSSNNSANISSGPGPGPG
PGPGPGPGPGPGPGPGPGPGPGPGSRPGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIR
HVMDGSLPTSLKHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHAL
LIKDVPATREVLGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSS
DPLGDTASNLGSAVDELMRHQPTLKTDATTAIIKLLEEICNLGRDPKYICQKPSIQKADG
TATAPPPRSNHAAEEASSEDEEEEEVQAMQSFNSTQQSETEPNQQVVDTEERIPIPLMDY
ILNVMKFVESILSNNTTDDHCQEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCK
SILTLSHEPKVLQEGLLQLDSILSSLEPLHRPIESPGGSVLLRELACAGNVADATLSAQA
TPLLHALTAAHAYIMMFVHTCRVGQSEIRSISVNQWGSQLGLSVLSKLSQLYCSLVWEST
VLLSLCTPNSLPSGCEFGQADMQKLVPKDEKTGTAQGGKKSDGEQDGTAGSMDASTQGLL
EGIGLDGDTLAPMETDEPTTSDSKGKSKITPAMAARIKQIKPLLSASSRLGRALAELFGL
LVKLCVGSPVRQRRSHHAASTTTAPTPAARSTASALTKLLTKGLSWQPPPYTPTPRFRLT
FFICSVGFTSPMLFDERKYPYHLMLQKFLCSGGHNALFETFNWALSMGGKVPVSEGLEHS
DLPDGTGEFLDAWLMLVEKMVNPTTVLESPHSLPAKLPGGVQNFPQFSALRFLVVTQKAA
FTCIKNLWNRKPLKVYGGRMAESMLAILCHILRGEPVIRERLSKEKEGSRGEEDAGQEEG
GSRREPQVNQQQLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHPPPIMGGVVRDLSM
SEEDQMMRAIAMSLGQDIPMDQRAESPEEVACRKEEEERKAREKQEEEEAKCLEKFQDAD
PLEQDELHTFTDTMLPGCFHLLDELPDTVYRVCDLIMTAIKRNGADYRDMILKQVVNQVW
EAADVLIKAALPLTTSDTKTVSEWISQMATLPQASNLATRILLLTLLFEELKLPCAWVVE
SSGILNVLIKLLEVVQPCLQAAKEQKEIQTPKWITPVLLLIDFYEKTAISSKRRAQMTKY
LQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVN
EETGNRRPVMLTLLRVPRLNKNSKNSNGQELEKTLEENKEMDIKRKENKGNDTPLALEST
NSEKETSLEETKMGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDH
KYAMMFAELKSTRMILNLTQSSGFNGFTPLVTLLLRHIIEDPCTLRHTMEKVVRSAATSG
AGSTTSGVVSGSLGSREINYILRVLGPAACRNPDIFTEVANCCIRIALPAPRGSGTASDD
EFENLRIKGPNAVQLVKTTPLKPSSLPVIPDTIKEVIYDMLNALAAYHAPEEADKSDAKP
GAMTQEVGQLLQDMGDDVYQQYRSLTRQTSDFDGQTGFSINSQVFAADGAAAENSTSGAS
QVEAAATPEESRDGKKDKEGDRASEEGKQKGKGSKPLMPTSTILRLLAELVRSYVGIATL
IANYSYTVGQSELIKEDCSVLAFVLDHLLPHTQNAEDKDTPALARLFLASLAAAGSGTDA
QVALVNEVKAALGRALAMAESTEKHARLQAVMCIISTIMESCPSTSSFYSSATAKTQHNG
MNNIIRLFLKKGLVNDLARVPHSLDLSSPNMANTVNAALKPLETLSRIVNQPSSLFGSKS
ASNKNKSEQDAQGASQDSNSNQQDPGEPGEAEVQEEDHDVTQTEVADGDIMDGEAETDSV
VIAGQPEVLSSQEMQVENELEDLIDELLERDGGSGNSTIIVSRSGEDESQEDVLMDEAPS
NLSQASTLQANREDSMNILDPEDEEEHTQEEDSSGSNEDEDDSQDEEEEEEEDEEDDQED
DEGEEGDEDDDDDGSEMELDEDYPDMNASPLVRFERFDREDDLIIEFDNMFSSATDIPPS
PGNIPTTHPLMVRHADHSSLTLGSGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGN
RQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFF
HDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVPIVNHLEFLRDEELEE
RREKRRKQLAEEETKITDKGKEDKENRDQSAQCAASKTSDSAEQNLSDGTPMPDSYPTTP
SSADAATSEAKETLGTLQPSQQQPALPPPPALGQAPRELQSPAAEGGGSTQLLMPVESEE
LGPTRPSGEAETTQMELSPAPTITSLSPERAEDSDALTAVSSQLEGSPMDTSSLASCTLE
EAVGDTSAAGNSEQPAAGSSTPGDAPPVGANVHGRGDGSGEPAQPPEDSSPPASSESSST
RDSAVAISGADSRGILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIRREVLQNQ
LGIRPPTRTAPSTNSSAPAVVGNPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQ
NASSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLM
HERLFGHSSTSALSAILRSPAFTSRLSGNRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSN
VDTLLRLRGRLLLDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHAQTRHWVIRSLLS
ILQRSSESELCIETPKLSTSEEKGKKSSKSCGSSSHENRPLDLLHKMESKSSNQLSWLSV
SMDAALGCRTNIFQIQRSGGRKHTEKHASSGSTVHIHPQAAPVVCRHVLDTLIQLAKVFP
SHFTQQRTKEPNCESDREKGSKQACSPCSSQTTSSGICTDFWDLLVKLDNMNVSRKGKNS
VKSVPVSAGGEGETSPYSLEASPLGQLMNMLSHPVIRRSSLLTEKLLRLLSLISIALPEN
KVSEAQANSGSSASSTTAATSTTSTTTTTAASSTSTPAATTPVTSTPALVAASAISTIAV
AASTTVTTPTTATTTVATSTKGSKSPAKVGEGGSGGADFKMVSSGLTENQLQLSVEVLTS
HSCSEEGLEDAANVLLQLSRGDPGTRDTVLKLLLNGARHLGYTLCKQIGTLLAELREYNL
EQQRRAQCETLSPDGLPEEQPQTTKLKGKMQSRFDMAENVVIVASQKRPLGGRELQLPSM
SMLTSKTSTQKFFLRVLQVIIQLRDDTRRANKKAKQTGRLGSSGLGSASSIQAAVRQLEA
EADAIIQMVREGQRARRQQQAATSESNQSEASVRREESPMDVDQPSPSAQDTQTIENEAA
LCCLATGQNLERISDGYQEKIASDGTPQGEKEKEERPPELPLLSEQLSLDELWDMLGECL
KELEESHDQHAVLVLQPAVEAFFLVHATERESKPPVRDTRESQLAHIKDEPPPLSPAPLT
PATPSSLDPFFSREPSSMHISSSLPPDTQKFLRFAETHRTVLNQILRQSTTHLADGPFAV
LVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKN
RLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHL
SYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLEND
VSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLA
AFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRA
LRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQ
LDLPAYESFEKLRHMLLLAIQECSEGFGLA
NT seq 13413 nt   +upstreamnt  +downstreamnt
atgaaagtagacaggactaaactgaaaaagacacctacagaggcccctgcagactgcaga
gccttaatagacaaactcaaagtttgtaatgatgagcaactcctcttggaactacagcag
atcaaaacatggaatattggaaagtgcgagttatatcactgggtggacctgttggaccgc
ttcgatggaattctggcagatgctggacagacagtggagaacatgtcatggatgctcgta
tgtgatagaccggaaagagagcaactgaaaatgcttcttttggctgtgttgaacttcaca
gccctgctcattgaatacagcttttctcggcatctgtacagttccatagagcatttgaca
actttattggcgtcctctgatatgcaagtggtgctggctgtccttaaccttctgtatgta
tttagcaaaagatcaaactatatcacacgtctgggatctgacaagaggaccccactgcta
acacggctgcaacatttggcagagagctggggtggaaaggagaatggctttggacttgca
gagtgttgcagagacttgcatatgatgaaatacccacccagtgcaactacactacacttt
gaattctatgcagaccctggggccgaggtcaaaattgagaagaagacaactagtaacaca
ctacattatattcacatagagcagcttgacaagatttcagaaagcccttctgaaatcatg
gaatctcttaccaaaatgtacagcattcctaaagataagcagatgctgttatttacacac
atacggctggcccatgggttttctaaccataggaagcgactacaagctgttcaggccaga
ctgcatgcaatatctatattagtgtattctaatgccttgcaggaatcagcaaacagtatc
ttgtacaatgggttgatagaggagttggtagatgtccttcagataacagataagcagctt
atggagattaaagctgcttctttacggacattaacatcaatcgtccacttggagagaact
cccaaactcagcagtattattgactgtactggaactgcctcctaccatggatttttgcct
gtacttgtgcggaactgtatccaggccatgattgatccttccatggatccgtacccccac
cagtttgccactgctctcttctcttttttataccatctggccagctacgatgctggtggt
gaagccttggtctcctgtggaatgatggaagccttattgaaggtcataaagtttcttggc
gatgaacaggatcagataacatttgttaccagagctgtgagggtggttgacctcatcacc
aacctggacatggcagcttttcaatcccatagtgggctttctatcttcatttatagactt
gagcatgaagtagatttgtgccgaaaagaatgtccatttgtgatcaagccaaagatccag
agacccagtaccacacaagaaggagaagaaatggaaactgatatggatgttgcagatgtg
actatggaaagcagtccaggctcatccatctctatggaacaacggctggatgttgaatta
aggacatcaagctccaacaacagtgctaacatctcttctggccctggccctgggcctggg
cctggccctggtcctggccctggccctggtcccggtcctggtcctggccctggccccggt
cccggccctggttctcgtcctggtgtgcagtgtattccacagcgagcagcacttctcaaa
tccatgctgaacttcctcaagaaagccattcaggaccctgctttctcggatggcatacga
catgtaatggatggttctctgcctacctccctgaaacacatcatcagcaatgcagaatac
tatggcccatcacttttcctcctagctactgaagtggtgactgtgtttgtatttcaagaa
ccatcactgctgtcctcactacaggacaatggattaacagatgtcatgctgcatgcactg
cttatcaaagatgttcctgctacccgtgaagtccttggctccctcccaaatgtattcagt
gcactctgcttgaatgcccgaggtcttcagtcttttgtacaatgtcagccttttgaacgt
ctcttcaaagttcttctctctccagattacctcccagccatgaggaggaggaggagttca
gatccccttggggatactgcatccaacctagggagtgctgttgatgagcttatgagacat
caacctaccctcaaaacagatgcaacaactgccatcatcaagttacttgaagaaatctgt
aatcttggaagagaccctaagtacatctgtcagaagccatctatccagaaggcagacggc
actgccactgctcctcccccaaggtctaatcatgctgcagaagaagcctctagtgaggat
gaggaggaagaggaagtgcaggccatgcagagctttaattctacacagcaaagtgaaaca
gagcctaatcaacaggttgttgatacagaggaacgtattcctattcccctcatggattac
atccttaatgtgatgaaatttgtggaatctattctgagcaacaatacaacagatgaccac
tgccaggaatttgtgaatcagaaaggactcttgcctttggttaccattttgggtcttccc
aatctgcccattgactttcccacatctgctgcctgtcaggctgttgcaggtgtctgcaaa
tccatattgacactatcacatgaacccaaagttcttcaggaaggtctccttcagttggac
tcaatcctctcctccttggagcccttgcaccgcccaattgaatccccagggggatcagtg
ttgttgcgagagctggcttgtgctggtaatgttgctgatgctaccctctcggcccaggcc
acacctctgctacatgcactcactgctgctcatgcctacattatgatgtttgttcatact
tgcagagttggacagagtgaaattcgttccatttctgtaaaccagtggggctctcagttg
ggtctgagtgttctgagcaaactgagccagttatactgttcgctagtatgggaaagcact
gttctcctctctctctgtaccccaaacagcctaccatctggttgtgaatttggccaggca
gacatgcagaaactggttccaaaggatgagaagacaggtacggcccagggcggaaaaaaa
tcagatggagaacaggatggaacagctggaagtatggatgcttctacccagggcttattg
gaaggcattggactagatggtgacacattggctcccatggagacagacgaacctactact
tcagactcgaagggcaaatctaaaatcacaccagccatggctgccagaatcaagcaaatc
aagcctttgttgtcagcttcatccagattaggccgagcacttgccgagctatttggactc
cttgttaaactttgtgtggggtctcctgtgcgccagagacggagtcatcatgccgccagc
acgactacagcaccaacacccgctgctcgatcaacagcctcagccctcactaagctactg
acaaagggtttgtcttggcagcctccaccatatacaccaacgccccgcttcaggctgaca
ttcttcatctgttcagttggtttcacatccccaatgctgtttgatgagaggaagtatccc
taccacctaatgctacagaaatttctctgctctggaggccacaacgctctttttgaaact
ttcaactgggctctgtccatgggaggcaaagtccctgtttctgagggactggagcattca
gatttacctgatggtacaggagaattcctagatgcctggcttatgctagtggagaagatg
gtgaatcccaccacggtgcttgaatctccacattcactgcctgccaaattgcctggaggt
gtccagaactttccacaattcagtgccctgcgctttcttgtggtaactcagaaagcagcc
tttacttgcatcaagaacctgtggaatcggaaaccgctgaaggtgtatggtgggcgaatg
gctgagtccatgctagctattttgtgccatatcctccgtggagaacctgtgattcgagag
agactgagcaaagagaaggagggatctcggggagaagaagatgcagggcaagaagaaggt
ggctcccgcagggaacctcaagtcaaccagcagcagctacaacagctcatggacatgggc
ttcacaagggaacatgccatggaggccttgttgaataccagcaccatggagcaggccaca
gagtaccttctaacccaccctcctccaatcatgggaggagttgttcgagatctcagcatg
tccgaagaggaccagatgatgagagcaattgccatgtctctgggacaggatattccaatg
gatcaaagggcagagtcacctgaggaagttgcttgcaggaaggaagaagaggaacggaaa
gcccgggaaaagcaagaagaagaagaagctaagtgtctggagaaatttcaggatgctgac
cctctggagcaagatgagctccatactttcacagataccatgttaccaggctgtttccac
cttcttgatgagctgccagacacagtgtaccgggtgtgtgatctgatcatgacagcaatc
aaacgtaatggagcagactatcgggacatgattctgaaacaagttgtcaatcaggtgtgg
gaagctgcggatgtattaatcaaagctgctcttccactgacaacaagtgacacaaaaact
gtgtcagagtggatcagtcagatggctactctgccccaggcctccaatttggctactaga
atcttgcttttaacattgctttttgaggagctgaagctgccttgtgcttgggtggttgaa
tccagtggcatccttaatgttctgatcaagctcttggaagtggttcagccttgcttacag
gccgccaaggagcaaaaggagatccagaccccaaagtggatcacccctgtgttgctcctg
attgatttctatgagaagacagccatatcctcaaaaaggagagcgcagatgactaagtac
ctacagtccaacagcaacaactggcgctggtttgatgatcgctctgggcgttggtgtagt
tacagcgcaagcaacaacagcactattgactctgcctggaaatcgggagaaacaagtgta
cggtttaccgcaggccgaagaagatacactgtccagttcactacaatggtgcaggttaat
gaggaaacaggaaatcgacgccctgtgatgctgactctcctcagggtaccacggctgaat
aaaaattcaaaaaacagcaatggacaagaactagagaagacgctggaagaaaacaaagaa
atggatatcaaacgcaaagaaaataaaggcaatgatacccccttggctctagagagtaca
aacagtgaaaaggagacaagcctggaagaaacaaaaatgggggagatactgatccagggc
ctgacagaagatatggtgactgttttaatccgggcctgtgtgagcatgttgggagtccct
gtggatccagacactttgcatgccacccttcgcctctgcctgaggctcacccgggaccac
aaatatgccatgatgtttgcagagctgaagagtacccgcatgatcttgaatttgacccag
agctcaggctttaatgggtttactcctctggtcacccttcttttaagacacatcattgag
gatccctgtaccctccgtcataccatggaaaaggttgttcgctccgcagcaacaagtgga
gcaggtagcactacctctggtgttgtatccggcagccttggctctcgagagattaactac
atccttcgtgtccttgggccagctgcatgccgcaatccagacatattcacagaagtggcc
aactgctgtatccgcatcgcccttccagcccctcgaggctcaggaactgcatcagatgat
gaattcgagaatcttagaattaaaggtcctaatgctgtacagctggtgaagacaactcct
ttgaagccctcgtctctgcctgtcattcctgatactatcaaggaagtgatctatgatatg
ctaaatgctctggctgcttatcatgctccagaggaagctgacaaatctgatgctaaacct
ggagctatgactcaggaagttggccagctcctgcaagacatgggcgatgatgtataccag
caataccggtcactcactcgtcagaccagtgactttgatggacagacaggcttttccatt
aatagtcaggtttttgctgcagatggtgccgccgctgagaattccacttctggggcctcc
caagtagaagccgctgcgactccagaggagtctcgagatgggaagaaagataaagaaggg
gaccgggcctctgaggaaggcaagcagaaaggcaagggcagcaaacctttaatgcctacc
tccactatccttcgtcttctggcagagttggtgagatcctatgttggtattgctaccctg
attgccaactacagctacactgtgggccagtctgagctgatcaaagaggactgcagtgtg
ctagctttcgtgctggaccacctcctcccgcatactcagaatgcagaagacaaggacaca
cctgccctggcccgcctgttcctcgcaagcctcgctgctgcagggagtggcacagatgcc
caagtagccctagtgaatgaagtgaaagcagcccttggacgagcactggctatggctgag
agtaccgagaaacatgccaggctgcaggcagtgatgtgcatcatcagtactatcatggag
tcctgcccctccacctccagcttctacagcagtgccacagccaagacccagcacaatggc
atgaacaacatcattcgactcttcctgaagaaggggctggttaatgacctggccagagtg
cctcacagcctagacctgtccagtcccaatatggccaacacagtcaacgctgctctgaag
cctttggaaacactttctcggattgtgaaccagcccagcagcctcttcggcagcaagagt
gcttctaacaagaacaagtctgagcaggatgcccaaggagcctcccaggactccaatagc
aaccagcaggatccaggcgagcctggggaagcagaagtgcaggaggaggatcatgatgtc
actcagacagaggtggcagatggggatatcatggatggggaggctgaaaccgactcagtg
gtgattgctgggcagcctgaggtgctcagttcacaagagatgcaggttgagaatgagctg
gaggacctgatagatgagttgcttgagagggatggcggatctgggaacagtacaattata
gtgagcagaagtggagaggatgaatcacaagaggacgtgctgatggatgaagctccttcc
aacctcagccaagcttccaccttgcaggccaaccgagaagattccatgaatatcctggac
cctgaggatgaggaggagcacactcaggaagaggacagcagtggcagtaacgaggatgag
gatgatagtcaggatgaagaggaggaggaggaggaagatgaggaagatgatcaggaggat
gatgaaggtgaagagggagatgaagacgatgacgacgatggctctgagatggaattggat
gaggattaccctgatatgaacgcttctcccttggtccgatttgaacgctttgaccgggag
gatgatctcatcattgagtttgacaacatgttctccagtgctacagacatccccccatcc
ccaggaaatatccctaccacccacccattgatggtacgtcatgcagaccacagctccctg
acgctgggcagcggctcctccacaacccgcctcacccagggcattggacgcagtcagagg
acgctgaggcagctgacagccaacacaggccacaccattcacgttcactatcctggaaat
cgccagcccaaccctccacttatactccagaggttactcggtccctcagctgctgctgac
atcctacagctgagcagtagccttcccctacaaagccggggccgggcccgcctcctggtg
ggcaacgacgacgtccacatcatcgccaggtctgatgacgaactactggatgactttttc
catgaccagagcacagctaccagccaagcaggaaccctgtccagcatccccacagccttg
acccgctggacagaagagtgcaaagttcttgatgctgagagcatgcacgactgcgtctca
gtggttaaagtgcccattgtcaatcacctggaattcctgagagatgaggagctagaagaa
aggagggagaaacgcaggaaacagctggctgaggaggaaacaaaaataactgacaaaggc
aaagaagataaggagaacagagatcagagtgcacagtgtgctgcatctaaaacaagtgac
tccgctgaacagaacctctcagatggaactcctatgcctgacagctacccaactacacca
tcttcagctgatgcagctacatctgaggccaaggagacccttggcactctgcagccctca
cagcagcaaccagcactcccacccccaccagccttgggacaggctcctcgggagctgcag
tccccagctgcagaagggggaggctctacacagctattgatgcctgtagagtcagaggaa
ttgggtcccacaaggccaagtggagaagcagagacaactcagatggagttatccccagct
cccaccataacctctctttccccagagagagctgaagattcggatgcattgacagctgtc
agcagtcaactggaaggctctcccatggacaccagcagcctggcctcctgtaccctagag
gaggctgtgggtgacacctcagcagctggcaattctgagcagcccgcagcaggcagctcc
actcctggggatgccccaccagttggggcaaatgtgcatggcaggggtgatgggtcaggg
gaacctgcccaacctcctgaggacagctctccccctgcatcctctgagagttcttccacc
agagattctgccgtggccatatctggagcagattcccgagggatcctagaagagccactg
ccttcaacaagcagcgaagaggaagatccacttgcaggtatcagtctccccgaaggtgtg
gacccctcttttctggctgctctgcctgatgacattcgtcgagaagtcctacagaaccag
ctgggcatccgtccaccaacccggactgccccttccacaaatagctcagctcctgcagtg
gtggggaatcctggtgtgactgaagtgagccccgagttcctggccgccctgcctccggcc
atacaggaagaagtgttggcacagcagagagctgagcagcagcgacgggaactagcacag
aatgccagctcagacacccccatggaccctgtcaccttcatccagactctgccctcagac
ctacgccgtagtgttctagaggacatggaggatagtgtgttggccgtgatgccacctgac
attgcagctgaggctcaagccctgagacgagagcaggaggcccggcaacggcagctcatg
catgagcgtctgtttgggcacagcagtacctctgcgctctctgccattctccgaagcccg
gctttcaccagtcgccttagtggtaaccgtggggtgcagtatactcgtcttgccgtgcag
agaggtggcaccttccaaatggggggtagcagcagccataacaggccttccggcagtaat
gtggacactctcctccgcctccgaggacggctccttctagaccatgaagccctgtcttgt
ctcctggtcctactttttgtggatgagccaaagctcaatacgagccgtctccaccgagta
ctgagaaatctctgctaccacgctcagacccgccactgggtcatccgcagcctcttgtcc
atcttgcagcgtagcagtgagagtgagctatgcattgaaacacctaagctctccacaagt
gaggaaaaagggaaaaaatcgagcaaaagctgtgggtcaagcagccatgagaaccgtccc
ctggatctgcttcacaaaatggaatcaaagagctccaaccagctttcctggctctcagtg
tccatggacgcagccttaggctgcaggactaatatattccagatccagcgttcagggggc
cgcaaacatactgagaagcatgcaagcagtggctccactgtccacatccacccccaggct
gctcctgttgtctgcagacacgttctggacacactcattcagttggccaaggtgtttccc
agccacttcacacagcagcggaccaaagaaccgaactgtgagagcgatcgggagaagggc
agtaagcaggcctgcagcccatgttcctcacagaccaccagcagtggcatttgcacagac
ttctgggacttgttggtaaaactggacaacatgaatgtcagccggaaaggcaagaactcc
gtgaagtcagtgccagtgagcgctggtggtgagggggaaacctccccgtacagcctggag
gcctctccactggggcagctcatgaacatgttgtcacaccccgtcatccgccggagctct
ctcctcaccgagaagctcctcagactcctttcgctcatctcaattgctctcccagaaaac
aaagtatcagaagcacaggctaattctggcagcagcgcttcctccaccactgctgccacc
tccaccacatctaccaccactaccactgccgcctcctccacatccacacccgctgcgacc
acccctgtcacttctactccagccctggttgctgcctccgctatttccaccattgccgta
gctgcttcaaccacagtgactacccccacgactgctaccactactgttgcaacttctact
aagggcagcaaatctccagcgaaagtgggtgaggggggcagcggcggtgcagactttaag
atggtatcctcaggcctcaccgaaaaccagctacagctctccgtggaggttttgacatcc
cactcttgttctgaagaaggcctagaagatgcagccaatgtgttactgcagctctctcgt
ggggaccctgggacccgggacacggttctcaagctgctactcaatggagcccgccatttg
ggttacaccctttgtaaacagataggtaccctgctagccgagctacgggaatataatctg
gaacagcaacggcgagcccagtgtgagaccctctctcctgatggcctgcctgaggagcag
ccacagaccaccaagctgaaaggcaaaatgcagagcaggtttgacatggctgagaatgtg
gtaattgtggcatcccagaagcgacccttgggtggccgggagctccagctgccttctatg
tccatgttgacatccaagacatctacccagaagttcttcttgagggtactacaggtcatc
atccagcttcgggacgacacacgccgagctaacaagaaagccaagcagacaggcaggcta
ggttcctccggtttaggctcagctagcagcatccaggcagctgttcggcagctggaggct
gaggctgatgccattatacaaatggtacgtgagggtcaaagggcccggagacagcaacaa
gcagcaacgtcggagtctaaccagtcggaggcatctgtccggagggaagagtcacccatg
gatgtggaccagccatctcccagtgctcaagatactcaaaccattgaaaacgaggctgca
ttgtgctgcttggctactgggcagaatttagaacgtatctccgatggataccaggaaaag
atagcttcagatggaaccccacagggggagaaggaaaaggaggagaggccgcctgaatta
ccgctgctcagtgagcagctgagcctggacgagctgtgggacatgctgggggagtgctta
aaggaactggaggaatcccacgaccagcatgcggtgctagtgctgcagcctgccgtcgag
gccttctttcttgtccatgccacagagcgcgagagcaagcctcctgtccgagacactcga
gagagccagctggcacacatcaaggacgagcctcctccactctcccctgcccccttaacc
ccagctacaccctcctcccttgaccccttcttctcccgggaaccctcatctatgcacatc
tcctcaagccttcctcccgacacgcagaagttccttcgctttgcagagactcaccgcact
gtgttaaaccagatcctacggcagtccaccacccacctcgccgacgggccttttgctgtc
ctggtggactacattcgtgtcctcgactttgatgtcaagcgcaagtatttccgccaggag
ctggagcgtttggatgaagggctccggaaagaagacatggctgtgcatgtccgccgtgac
catgtgtttgaagattcctatcgtgagctgcatcgcaaatcccctgaagaaatgaagaat
cgattgtatatagtattcgaaggagaagaagggcaggatgctggagggctcctgcgggag
tggtatatgatcatctctcgagagatgtttaacccgatgtatgccttgttccgtacctca
cccggtgatcgagtcacctacaccatcaacccgtcttcccactgcaaccccaaccacctc
agctacttcaagtttgttggacgcattgtggccaaagctgtatatgataaccgcctcctg
gaatgctacttcactcggtccttctacaaacacatcttgggcaagtctgtcagatacaca
gatatggagagtgaagattaccacttctaccagggcctggtttatctgctggaaaatgat
gtctctacactaggctatgacctcaccttcagcactgaggtccaagagtttggagtctgt
gaagttcgtgacctcaaacccaatggggccaacatcttggtaacagaggagaataagaag
gagtatgtacacctggtgtgccagatgagaatgacaggggctatccgcaaacagctggct
gctttcttagaaggcttctatgagatcattccgaagcgcctcatttccatcttcaccgag
caggaattagagctgctcatatcaggactgcccaccattgacattgatgacctgaaatcc
aacactgagtaccataagtaccagtccaactctattcagatccaatggttctggagagca
ttgcgttctttcgaccaagctgaccgtgccaagttcctccagtttgtcacgggtacatcc
aaagtgcccctacaaggctttgctgccctcgaaggcatgaatggcatccagaagtttcag
atccatcgagatgacaggtccacggatcgcctgccttcagctcacacatgttttaatcag
ctggacctgcctgcctatgagagctttgagaagctccgccacatgctactattggccatc
caggagtgctctgaaggttttgggctggcctaa

DBGET integrated database retrieval system