Oryctolagus cuniculus (rabbit): 100342662 Help Entry 100342662         CDS       T03373                                  Name (RefSeq) histone H2B subacrosomal variant   KO K11252   histone H2B Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05203   Viral carcinogenesis ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100342662  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100342662   09163 Immune disease    05322 Systemic lupus erythematosus     100342662   09165 Substance dependence    05034 Alcoholism     100342662  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100342662   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100342662 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100342662 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100342662 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Adeno_E1B_55K AAA_lid_2 Cep192_D1 Motif Other DBs NCBI-GeneID:  100342662 NCBI-ProteinID:  XP_002721166 Ensembl:  ENSOCUG00000022045 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MARSNIRKYKYSRGCLIPISRKKSHCSCDSGHRNYSLYVKRVLKEVVPHRHMSSCTLEVM NTLINHMFERIAVEACNMMYFRNRCTLTPEDIQKAVYLLLPGKLGKHAVTFGSEAVHRFF HY NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggccagatccaacatcagaaagtacaagtactccagaggatgtctaatccccatctcc agaaagaaatcacattgcagctgcgattctggccatagaaactattctctctatgtgaag agggtcctgaaggaggttgttccccataggcacatgtcatcttgcaccttggaggtcatg aacaccttgatcaaccacatgttcgagcgcattgccgtggaagcctgcaacatgatgtat ttcagaaaccgctgcaccctcaccccggaagacatccagaaggcagtgtatttgctgttg cctgggaaactaggcaagcacgcggtgacttttgggagcgaagcggtccacagattcttc cactactaa

DBGET integrated database retrieval system