KEGG   Oryctolagus cuniculus (rabbit): 100342669
Entry
100342669         CDS       T03373                                 
Symbol
MGRN1
Name
(RefSeq) mahogunin ring finger 1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342669 (MGRN1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100342669 (MGRN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342669 (MGRN1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100342669 (MGRN1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100342669 (MGRN1)
SSDB
Motif
Pfam: zf-C3HC4_3 Prok-RING_4 zf-RING_2 zf-RING_5 zf-C3HC4_2
Other DBs
NCBI-GeneID: 100342669
NCBI-ProteinID: XP_008247838
Ensembl: ENSOCUG00000005769
LinkDB
Position
Un
AA seq 494 aa
MGGEKFDTPHPEGYLFGENMDLNFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLV
RYKEDADSPTEDSEKPRVLYSLEFTFDADARVAITIYCQATEEFLNGVAVYSPKSPALQS
ETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVVQAVVDEGDVVEVTGHAH
VLLAAFEKHVDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPADDENSDNSNEC
VVCLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSP
ISFSPVLAQSVDHDEHSSSDSIPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGVS
DGLAQASCPLAGIERVMDSGHQKGRLRGESPDSTLRSPSSPIHEEDEGKLSEDSDAPPPP
TGVELALRESSSPESFLTDEVDESPLKQGSRVPSIEDVLQDGSPEHHGLGQPGPPADIYL
PALGPESCSVGIEE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgggaggcgagaaatttgacaccccccaccctgaaggttacctctttggagagaacatg
gatctgaacttcctgggcagccgccccgtccagttcccctacgtcactcctgccccccac
gagcccgtgaagacgctcaggagcctggtgaacatccgcaaggactccctccggctcgtg
aggtacaaggaagacgcggacagtcccactgaggacagcgagaagccgcgggtgctctac
agcctggagttcaccttcgacgctgacgcccgggtggctatcaccatctactgccaggcg
accgaggagttcctgaacggtgtggccgtgtacagccccaagagccctgctctgcagtcg
gagaccgtccactataagagaggggtgagccagcagttctctctgccttccttcaagatc
gacttctccgagtggaaggatgacgagctgaacttcgacctggaccggggtgtgtttcca
gtggttgtccaggccgtggtggacgaaggagacgttgtggaagtgactggccatgcccac
gtgctcttggcagcctttgagaagcacgtggacggcagcttctccgtgaagcctctaaag
cagaagcagatcgtggaccgggtcagctacctgctgcaggagatctacggcatcgagaac
aagaacaaccaggagaccaagcccgcggatgatgagaacagtgacaatagcaacgaatgt
gtggtgtgcctgtccgacctccgagacacgctgatcctgccctgccgccacctgtgtctg
tgcacctcgtgcgccgacacgctgcgctaccaggccaacaactgccccatctgccggctg
ccgttccgggccctcctgcagatccgagctgtgcggaagaagccaggggccctgtctccc
atctccttcagccccgtcctggcccagagcgtggaccacgatgagcactctagctcggac
agcatcccgcccggctacgagcccatctccctgctcgaggcgctcaacggtttacgtgcg
gtctccccggccatcccgtccgcccccctgtatgaggagatcacctactcgggcgtgtcg
gacggcctggcccaggccagctgtcccctggctgggatcgagcgcgtcatggacagcggc
catcagaagggcaggctgcggggcgagtctcccgacagcaccctgcggtccccgtcatcc
cccatccacgaagaggacgaggggaagctgtcagaggactcggacgcccctcctccgccc
actggggtggagctggcgctgcgggagagcagctcccccgagagcttcctgacggacgaa
gtggacgagtccccgctgaagcaaggaagcagagtgccgtccatcgaggacgtcctgcag
gacggcagcccggagcaccacggcctcggccagccaggcccgccggccgacatctacctg
ccagccctggggcccgagtcctgctctgttggtatagaggagtga

DBGET integrated database retrieval system