KEGG   Oryctolagus cuniculus (rabbit): 100342746
Entry
100342746         CDS       T03373                                 
Symbol
CSF3R
Name
(RefSeq) colony stimulating factor 3 receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100342746 (CSF3R)
   04151 PI3K-Akt signaling pathway
    100342746 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100342746 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100342746 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342746 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100342746 (CSF3R)
   04090 CD molecules [BR:ocu04090]
    100342746 (CSF3R)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  Prolactin receptor family
   100342746 (CSF3R)
CD molecules [BR:ocu04090]
 Proteins
  100342746 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind fn3_2
Other DBs
NCBI-GeneID: 100342746
NCBI-ProteinID: XP_008271884
Ensembl: ENSOCUG00000011231
LinkDB
Position
Un
AA seq 840 aa
MAALRTCCLAGAALIALLLPGSLETCGRISLSASTVRLGAPITASCTISQNCSQLYLEPQ
IIRWKLGTEIQPGARQWQWPDGTQESIITLPHFNYTQAFLSCCLQWGSNLQILDQAELRA
GYPPAIPRNLSCFMDLMTSSLTCQWEPGPETHLPTNFTLKSFKSRGNCQTQEDAIMGCVP
EDTHSYCSIPRKHLLLYQSMGIWVQAENALGTSVSPQLCLDPMDVVKLEPPTLWALDSSP
KGAPPQPGCLQLHWEPWKPSHFIDQKCELRHQPQLEEDNWTLVAPLPSMTVQYELCGLLP
ATVYVLQMRCTRWPLPGHWSAWSPSLERRTTERVPVVRLDAWLRQRQLDPGTPEAQLFWK
PTPQEEESGQIQGYLVSWKPSGQAGAALPLCNTTELGCTFHLPPGAGEVALVAYNTAGAS
QPAPVIFSEHRGPPLVGLHAVGQDPHSLWVGWEPPSLQPQGYVIEWGPGAPSPSSSKTWR
VEQDGNLTGTLLRENVRPFQVYEIAVTPLYQAAVGPSQHIYAYSQETAPSHAPELQLKHI
DRTWAQLEWVPEPPELGKSPLTHYTIFWTNTQDQLFSTTLNASSHGFVLHGLEPASVYHV
HLMAASQAGATNSTSLTLMTLALEESVLHILLGLSGSLFLLLCLCGTTWLCCSPRKNPLW
PNVPDPAHSSLGSWVPTVMAEEAFQLPSLRDPDMPSITKITVLEEEEKKPGHWESSGSPE
SCGLPTLVQAYVLQGDPRAASTQPQPPSPTSDQVFYGQVLGSPTSPWPGHYLRCDSTQPL
LGGLTPSPKSYENLWFQXQPLGTPMARPPSQENDCIFGPLLDFPLLQGLRVHGMEGPGAF
NT seq 2523 nt   +upstreamnt  +downstreamnt
atggcggcgctgagaacctgctgcctggccggggctgcactgatcgccctgctgctcccc
ggaagcctggagacatgcgggcgcatcagcctctctgcgtccaccgtgcgcctgggggct
cccatcactgcctcctgcaccatcagccagaactgtagccagctgtacctggagccacag
attattaggtggaaactgggaacagagatacaaccaggagccaggcagtggcagtggcct
gatgggacccaggaatcaatcatcacgctgccccacttcaactacactcaggccttcctc
tcctgctgtctgcaatggggcagcaacctgcagatcctggatcaggctgagttgcgagca
ggctacccccccgccataccgcgcaacctgtcctgcttcatggacctcatgaccagcagc
ctcacctgccagtgggagccagggcccgagacccacctgcccaccaacttcaccctgaag
agcttcaagagccggggcaactgtcaaacccaagaggacgccatcatgggctgcgtgcca
gaggacacgcacagctactgctccatcccgcgcaaacacctgctgctctaccagagcatg
ggcatctgggtgcaggcagagaacgcgctggggaccagtgtgtctccgcagctgtgcctc
gatcccatggacgtagtgaagctggagccccctacgctgtgggccctggactccagcccc
aagggggccccaccccagccaggctgcctgcagttgcactgggagccgtggaagccaagc
cattttatcgaccagaagtgcgagctacgccaccagccacagcttgaagaagacaactgg
acactggtggcccccctgccctccatgaccgtccagtatgaactctgcgggctcctccca
gccaccgtctacgtcctgcagatgcgctgcacccgctggcccctacccggccactggagt
gcatggagccccagcctggagcggagaaccaccgaacgggtccccgtggtcagactggat
gcatggttgcggcagaggcagctggaccctgggaccccggaggcgcagctgttctggaag
ccaacaccccaggaggaagagagcgggcaaatccaagggtatctggtctcctggaaaccc
tcaggccaggctggggccgccctgcccctctgcaacaccacggagttgggctgcaccttc
cacttgcctccaggagccggggaggtggccctggtggcctacaacaccgctggggcctcc
cagcccgccccagtgatcttctcggagcacagaggtccacccctggttgggctccatgct
gtgggccaagacccccacagcctctgggtgggctgggagccccccagtcttcagcctcag
ggctatgtgattgagtggggcccaggtgcccccagccccagcagcagcaagacctggagg
gtggagcaggatgggaacctcacagggactctgcttcgagagaacgtcaggcccttccaa
gtctacgagatcgccgtgactccgctgtaccaggcagccgtgggaccctcccagcacatc
tatgcctactcccaggagacagccccctctcacgccccggagctgcaactcaagcacatt
gacaggacctgggcacaactggagtgggtgcctgagccccctgagctggggaagagcccc
ctgacccattacaccatcttctggaccaacactcaggaccagttattctccaccactctg
aatgcctcctcccacggctttgtcctccatggcctggagccggccagtgtgtatcatgtc
cacctcatggctgccagccaggccggggccaccaacagtacgagtctcaccctgatgacc
ttggccctagaggagtctgtgctgcacatcctcctgggcctgtccggcagcctcttcttg
ctcttatgcctctgtgggaccacctggctctgttgcagtcccaggaagaatccgctctgg
ccaaatgtgccagacccagcccacagcagcctgggctcctgggtgcccaccgtcatggca
gaggaggccttccagctgcccagccttcgagaccctgacatgccatccatcaccaagatc
acggtgctggaggaggaagaaaagaagccagggcactgggagtccagtggcagcccagag
agctgtggcctccccaccttggtccaggcctacgtactccagggggacccaagagcagct
tccacccagccccagcccccgtctcccaccagtgaccaggtcttttatgggcaggtgctg
ggcagccccacaagcccatggccagggcactacctgcgctgtgactccacgcagcccctc
ttggggggcctcacccccagccccaagtcctatgagaacctctggttccagnaccagcct
ctgggaacccctatggcccgacccccaagccaggagaatgactgtatcttcgggccactg
ctggacttccccctcttgcagggactccgagttcatggcatggagggcccgggggccttc
tag

DBGET integrated database retrieval system