KEGG   Oryctolagus cuniculus (rabbit): 100342807
Entry
100342807         CDS       T03373                                 
Symbol
ATG5
Name
(RefSeq) autophagy related 5
  KO
K08339  autophagy-related protein 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04136  Autophagy - other
ocu04137  Mitophagy - animal
ocu04140  Autophagy - animal
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04216  Ferroptosis
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100342807 (ATG5)
   04136 Autophagy - other
    100342807 (ATG5)
   04137 Mitophagy - animal
    100342807 (ATG5)
  09143 Cell growth and death
   04216 Ferroptosis
    100342807 (ATG5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100342807 (ATG5)
   04622 RIG-I-like receptor signaling pathway
    100342807 (ATG5)
  09149 Aging
   04211 Longevity regulating pathway
    100342807 (ATG5)
   04213 Longevity regulating pathway - multiple species
    100342807 (ATG5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100342807 (ATG5)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100342807 (ATG5)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100342807 (ATG5)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100342807 (ATG5)
SSDB
Motif
Pfam: APG5 DUF6782
Other DBs
NCBI-GeneID: 100342807
NCBI-ProteinID: XP_008261555
Ensembl: ENSOCUG00000013358
LinkDB
Position
12:complement(94312965..94468134)
AA seq 275 aa
MTDDKDVLRDVWFGRIPTCFTLCQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKNFPEKDLLHCPSKDA
IEAHFMSCMKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEES
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIAPEDGGKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
NT seq 828 nt   +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtgtggtttggacggattccaacttgcttc
actctgtgtcaggatgaaataactgaaagggaagcagaaccatactatttgctattgcca
agagtaagttatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagacattagtgagatatggtttgaatatgaaggcacaccactgaaatggcat
tatccaattggtttgctatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtccattttaagaattttccagaaaaggaccttctgcactgtccatctaaggatgca
attgaagctcattttatgtcttgtatgaaagaagctgatgctttaaagcataaaagtcaa
gtaattaatgaaatgcagaaaaaagatcacaagcagctgtggatgggattacaaaatgac
agatttgaccagttttgggccatcaatcgcaaactcatggaatatcctgcagaagaaagt
ggatttcgttatatcccatttagaatatatcagacgacgactgaacgacctttcattcag
aagctgtttcgtcctgtggctgcagatggacagctgcatacacttggcgatctcctcaaa
gaagtgtgtccttccgcaattgctcctgaagatgggggaaaaaagaatcaagtgatgatt
catggaattgagccaatgttggaaacgcctctccagtggctgagtgagcatctgagctac
ccggataactttcttcatattagtatcatcccacagccgacagattga

DBGET integrated database retrieval system