KEGG   Oryctolagus cuniculus (rabbit): 100342825
Entry
100342825         CDS       T03373                                 
Symbol
UBE3A
Name
(RefSeq) ubiquitin protein ligase E3A
  KO
K10587  ubiquitin-protein ligase E3 A [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05165  Human papillomavirus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342825 (UBE3A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100342825 (UBE3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100342825 (UBE3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342825 (UBE3A)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100342825 (UBE3A)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100342825 (UBE3A)
SSDB
Motif
Pfam: HECT AZUL AIF-MLS
Other DBs
NCBI-GeneID: 100342825
NCBI-ProteinID: XP_008267977
Ensembl: ENSOCUG00000017465
UniProt: G1TKQ8
LinkDB
Position
17:80790786..80887326
AA seq 881 aa
MATACKRSPGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFHR
MDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSEIKMNKKEGKGPRID
FKDVTYLTEDLVYEILELCREREDYSPLIRVIGRVFSNAEALVQSFRKVKQHTKEELKSL
QGKDEDKDEDEKEKAACSAAVAAAAAAAMEEDSEASSSRFGDSSQGDNNLQKLGPDDVSV
DIDAIRRVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENR
NLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKYSADQIRRMMETFQQLITYKVISN
EFNSRNLVNDDDAIVAASKCLKMVYYANVVGGDVDTNHNEEDDEEPIPESSELTLQELLG
EERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNDVLEMDKDYTFFKVETENK
FSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIID
DALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDE
STKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDS
HPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFV
NLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETT
EYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDT
ERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
NT seq 2646 nt   +upstreamnt  +downstreamnt
atggccacagcttgtaaaagatcaccaggagaacctcagtctgacgacattgaagctagc
cgaatgaagcgagcagctgcaaagcatctaatagaacgctactaccatcagttaactgag
ggctgtggaaatgaggcctgcacgaatgagttttgtgcttcctgtccaacgtttcatcgt
atggataacaatgcagcagctattaaagcccttgagctttataagattaatgcaaaactc
tgtgatcctcatccctccaagaaaggagcaagctcagcttaccttgagaactcgaaaggt
gcccctaacaactctgagataaaaatgaataagaaggaaggaaaaggacctcgaattgat
tttaaagatgtgacatacctaactgaagatttggtatatgaaattcttgaattatgtaga
gagagagaggattattcacctttaatccgtgttattggaagagttttttcaaatgctgag
gcattggtccagagctttcggaaagtcaaacaacacacgaaggaagaactgaaatctctt
cagggaaaggatgaagacaaggatgaagatgaaaaggaaaaagctgcatgttctgctgct
gttgctgctgctgctgctgctgctatggaagaggattcagaagcatcttcctcaaggttt
ggtgatagttcacagggagacaacaatttacaaaagttaggcccggatgatgtgtctgtg
gatattgatgccattagaagggtctatacccgattgctctctaatgaaaaaatagaaact
gcctttctcaatgcacttgtatatctgtcacctaatgtggaatgtgatttgacatatcac
aatgtatactcccgagatcctaattatctgaatttgtttattattgtaatggaaaataga
aatctccacagtcctgaatatctggaaatggctctgccattattttgcaaagcaatgagc
aagctaccccttgcagcccaaggaaaactgattagactgtggtctaaatacagtgcagac
cagattcggagaatgatggaaacatttcagcagcttattacttacaaagtcataagcaat
gaatttaacagtcgaaatctggtgaatgatgatgatgccattgttgctgcttccaagtgc
ttgaaaatggtttactatgcaaatgtagtcggaggggatgtggacacaaatcacaatgaa
gaagatgatgaagaacccatccctgagtccagtgagttgacacttcaggagcttttggga
gaggaaagaagaaacaagaaaggtcctcgggtggacccactggaaactgaacttggtgtt
aaaactctggattgtcgaaaaccacttatcccttttgaagaatttattaatgaaccactg
aatgatgttctagaaatggataaagattatacttttttcaaagtagaaacagagaacaag
ttctcttttatgacatgtccctttatattgaatgctgtcacaaagaatttgggattatat
tatgacaatagaattcgcatgtacagtgaacgaagaatcactgttctctacagcttagtt
caaggacagcagttgaatccatatttgagactcaaagtcagacgtgaccatatcatagat
gatgcacttgtccggctagagatgatcgctatggaaaatcctgcagacttgaagaaacag
ttgtatgtggaatttgaaggagaacaaggagttgatgagggaggtgtttccaaagaattt
tttcagttggttgtggaggaaatcttcaatccagatattggtatgttcacatatgatgaa
tccacaaaattgttttggtttaacccatcttcttttgaaactgagggtcaatttactttg
attggcatagtactgggtctggctatttacaataactgtatactggatgtacattttccc
atggttgtctacaggaagctaatggggaaaaaaggaacttttcgtgacttgggagattct
cacccagttctatatcagagcttaaaggatttattggaatatgaaggtaatgtggaagat
gatatgatgatcactttccagatatcacagacagatctttttggtaacccaatgatgtat
gatctaaaggaaaatggtgacaaaattccaattacaaatgaaaacaggaaggaatttgtt
aatctctattctgactacattctgaataaatcagtagaaaaacagttcaaggcttttcgc
agaggttttcatatggtgaccaatgaatctcccttaaagtacttatttagaccagaagaa
attgaattgcttatatgtggaagccggaatctagatttccaggcactagaagaaactaca
gaatatgacggtggctataccagagactctgttctgattagggagttctgggaaatcgtt
cattcatttacagatgagcaaaaaagactcttcttgcagtttacaactggtacagacaga
gcacctgtgggaggactaggaaaattaaagatgattatagccaaaaatggcccagacaca
gaaaggttacctacatctcatacttgctttaatgtccttttacttccggaatattcaagc
aaagaaaagcttaaagagagattgttgaaggccatcacatatgccaaaggatttggcatg
ctgtaa

DBGET integrated database retrieval system