Oryctolagus cuniculus (rabbit): 100342999 Help Entry 100342999         CDS       T03373                                  Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04144   Endocytosis ocu04510   Focal adhesion ocu05020   Prion disease ocu05100   Bacterial invasion of epithelial cells ocu05205   Proteoglycans in cancer ocu05410   Hypertrophic cardiomyopathy ocu05412   Arrhythmogenic right ventricular cardiomyopathy ocu05414   Dilated cardiomyopathy ocu05416   Viral myocarditis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100342999   09144 Cellular community - eukaryotes    04510 Focal adhesion     100342999  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100342999   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     100342999   09164 Neurodegenerative disease    05020 Prion disease     100342999   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100342999    05410 Hypertrophic cardiomyopathy     100342999    05412 Arrhythmogenic right ventricular cardiomyopathy     100342999    05414 Dilated cardiomyopathy     100342999    05416 Viral myocarditis     100342999  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100342999 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     100342999 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  100342999 NCBI-ProteinID:  XP_002720655 Ensembl:  ENSOCUG00000005950 UniProt:  G1TZQ2 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MMAEEHTDLEAQMVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQMCSSIKVLLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaggagcacacggacctggaggcgcagatggtcaaggacatccactgcaag gagatcgacctggtgaaccgggaccccaagaacatcaacgaggacatcgtcaaggtggat ttcgaagacgtgatcgcagagcccgtgggcacctacagcttcgacggggtgtggaaagtg agctacaccaccttcaccgtgtccaagtactggtgctaccgcctgctgtccacgctgctg ggcgtcccgctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggccgtggtgccatgcatcaagagctacctgatcgagatccagtgcatcagccacatc tactcgctctgcatccgcaccttctgcaacccgctcttcgccgccctgggccagatgtgc agcagcatcaaggtgctgctgcgcaaggaggtgtga

DBGET integrated database retrieval system