Oryctolagus cuniculus (rabbit): 100343141 Help Entry 100343141         CDS       T03373                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05203   Viral carcinogenesis ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100343141  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100343141   09163 Immune disease    05322 Systemic lupus erythematosus     100343141   09165 Substance dependence    05034 Alcoholism     100343141  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100343141   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100343141 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100343141 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100343141 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100343141 NCBI-ProteinID:  XP_008260673 UniProt:  G1TP83 LinkDB All DBs Position 12:144924354..144924803 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacccgcgaagtcggcgccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaagagagctactcggtc tacgtgtacaaggtgctcaagcaggtgcatcccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcgcgc ctggcgcactacaacaagcgctcgaccatcacgtcgcgcgagatccagacggctgtgcgc ctgctgctgcctggcgagctggccaagcacgctgtgtccgagggcaccaaggctgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system