KEGG   Oryctolagus cuniculus (rabbit): 100343272
Entry
100343272         CDS       T03373                                 
Symbol
UBE2G2
Name
(RefSeq) ubiquitin conjugating enzyme E2 G2
  KO
K04555  ubiquitin-conjugating enzyme E2 G2 [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04141  Protein processing in endoplasmic reticulum
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100343272 (UBE2G2)
   04120 Ubiquitin mediated proteolysis
    100343272 (UBE2G2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100343272 (UBE2G2)
   05022 Pathways of neurodegeneration - multiple diseases
    100343272 (UBE2G2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100343272 (UBE2G2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100343272 (UBE2G2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100343272 (UBE2G2)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 100343272
NCBI-ProteinID: XP_002723707
Ensembl: ENSOCUG00000012944
LinkDB
Position
Un
AA seq 165 aa
MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSF
PLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKIL
LSVVSMLAEPNDESGANVDASKMWRDDREQFYKIARQIVRKSLGL
NT seq 498 nt   +upstreamnt  +downstreamnt
atggcgggtacggcgctcaagaggctgatggccgagtacaaacaattaacgctgaatccc
ccagaaggaattgtggcaggtcccatgaacgaggagaatttttttgagtgggaggcgctg
atcatgggcccagaagacacctgctttgagtttggtgttttccccgccatcctgagtttc
ccacttgattacccgttaagtcccccgaagatgagattcacctgtgagatgtttcacccc
aacatctacccggacgggagggtctgcatctcgatcctgcacgcgccaggggacgacccc
atgggctacgagagcagcgccgagaggtggagcccagtgcagagcgtggagaagattctg
ctgtccgtggtgagcatgctggcagagcccaacgacgagagtggagcgaacgtggacgct
tccaagatgtggcgtgacgaccgggagcagttctacaagatcgccaggcagatcgtgcgc
aagtccctggggctgtga

DBGET integrated database retrieval system