KEGG   Oryctolagus cuniculus (rabbit): 100343288
Entry
100343288         CDS       T03373                                 
Symbol
IL18RAP
Name
(RefSeq) interleukin 18 receptor accessory protein
  KO
K05174  interleukin 18 receptor accessory protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100343288 (IL18RAP)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100343288 (IL18RAP)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    100343288 (IL18RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100343288 (IL18RAP)
   04090 CD molecules [BR:ocu04090]
    100343288 (IL18RAP)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL1 receptor family
   100343288 (IL18RAP)
CD molecules [BR:ocu04090]
 Proteins
  100343288 (IL18RAP)
SSDB
Motif
Pfam: Ig_6 TIR Ig_2 Ig_3 I-set TIR_2 Ig_4 Ig_5 ig
Other DBs
NCBI-GeneID: 100343288
NCBI-ProteinID: NP_001315997
Ensembl: ENSOCUG00000006067
UniProt: G3EPL2
LinkDB
Position
2:complement(89984687..90022325)
AA seq 549 aa
MCCLGWMFLWLVAEENIQGLSISETEKSYLHHRNQCSTTQGPQRLPCSGSRDLSDVQWYL
QPQDGDPLGEITPSHPHIIQDKSTLRFLAPATNNSGLYVCRPRIRTPWDEACCVKTILKV
KPQTNASCKNHVSHKQSLLLGSTAYIYCPGLNCQSDMQNPEMTWYQNGRLLSDKRNNPMM
VDEIYDYHQGTYVCDYTQSDNEGSWTVRAVVQVRTIVKNTNLKPDILEPIKDTLEVELGK
PLSLHCKARFGFERDFNPVIRWYIKESDKVWEVPIPQGKSVKSTFEDEIIERIFFLKEVT
RRDLRKRFLCFAQNSIGNATQSIQLKEKKGVVFVYILLGTVLTLLAVLTASAVLYTYWIE
IALLWQSCQNKDETLGDEKEFDAFVSYAKWSSLEGVASPSLSEELLALNLFPEVLENKYG
YTLCLLDRDVAPGGVYAEDIVNIIKKSRRGIFVLSPNYVNGPSVFELQAAVNLALDDKTL
KLILIKFCAFEEPESLPHLVKKALRVLPTVTWRGIKSVPPSSWFWTQIRYHMPVKNTKGF
TCNKFKTMS
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtgctgcttgggctggatgtttctttggcttgttgcagaagagaacattcagggactt
tctatttcagagacagagaaatcatacttacatcatagaaatcaatgctcaacgacccaa
ggccctcaacgcctgccctgcagtggcagtagggacctatctgatgtgcagtggtaccta
cagccacaggatggagatcctcttggcgaaatcactccaagccatcctcatatcattcaa
gacaagagcactcttcgttttttagccccagcgacgaataattccgggttatatgtttgt
agacccaggattaggaccccgtgggatgaggcctgttgtgtgaaaacaatcttaaaagtt
aaacctcagacaaatgcgtcctgcaagaaccatgtctcacataagcaaagccttcttctc
ggtagcaccgcctatatttattgccccggtctcaactgccaaagtgatatgcaaaatccg
gagatgacctggtaccagaatggaagactcctctctgacaaaaggaacaaccccatgatg
gtggatgagatttatgactatcaccagggcacatatgtgtgtgattacactcagtcggat
aatgaaggctcatggacagtcagagctgttgttcaagtaagaaccattgtgaaaaacact
aatctcaaaccagatattttggaacccatcaaggataccctggaagtagaacttggaaaa
cctttaagtcttcactgcaaagcacgatttggctttgaaagggactttaaccctgtgata
aggtggtacatcaaagagtccgacaaggtgtgggaagtcccaatacctcagggaaaaagt
gttaaatccacatttgaggatgaaatcattgagcgtattttcttcttgaaagaagtgact
cggcgcgatcttcgcaagagattcctttgctttgctcagaactccatcgggaacgcaacc
cagtccattcagctgaaggaaaagaaaggagtggtgttcgtgtacatcctgctcggcacc
gtgttgaccctgctggccgtgctcacggcgagtgctgtcctctacacgtactggattgaa
atagcgctgctgtggcagagctgccagaacaaggatgagacgctcggagatgaaaaggaa
tttgatgccttcgtatcctatgcgaaatggagctctttggagggtgtggcctcgccatct
ctgagtgaggaactcctggctttgaatctgttccctgaggttttggagaacaagtatgga
tacaccttgtgtttgctggacagagatgtggctccgggaggagtgtatgcagaagacatt
gtgaacatcattaagaaaagcagaagaggaatctttgtcttgagccccaactatgtcaac
ggacccagtgtctttgaactgcaggcagcagtaaatcttgccttggatgataaaactctg
aaactaattttaattaagttctgtgcatttgaagaaccagagtctctacctcatcttgtg
aaaaaagctctaagggttttgcccactgtcacatggagaggcataaaatccgtgcctccc
agttcctggttctggacccagatacgctaccacatgcctgttaaaaacacaaaaggattc
acatgcaacaaattcaaaactatgtcatga

DBGET integrated database retrieval system