KEGG   Oryctolagus cuniculus (rabbit): 100343309
Entry
100343309         CDS       T03373                                 
Symbol
UBA3
Name
(RefSeq) ubiquitin like modifier activating enzyme 3
  KO
K10686  NEDD8-activating enzyme E1 [EC:6.2.1.64]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100343309 (UBA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100343309 (UBA3)
Enzymes [BR:ocu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.64  E1 NEDD8-activating enzyme
     100343309 (UBA3)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   100343309 (UBA3)
SSDB
Motif
Pfam: ThiF E2_bind UAE_UbL Shikimate_DH Pyr_redox
Other DBs
NCBI-GeneID: 100343309
NCBI-ProteinID: XP_002713351
Ensembl: ENSOCUG00000008169
UniProt: G1SUM3
LinkDB
Position
9:complement(36464472..36501357)
AA seq 463 aa
MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGPFTHPDFEPST
ESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDV
GRPKAEVAAEFLNDRVPNCNVVPHFNKIQDFSDTFYRQFHIIVCGLDSIIARRWINGMLI
SLLNYEDGVLDPSSIIPLIDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIA
SMPRLPEHCIEYVRMLQWPKEQPFGEGIPLDGDDPEHIQWIFQKSLERASQYNIRGVTYR
LTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDGLYTYTFEAER
KENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTS
IEERTRPNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcggatggcgaggagccggagaagaaaagaaggagaatagaggagctgctggctgag
aaaatggctgttgatggtgggtgtggggacactggagactgggaaggtcgctggaaccat
gtaaagaagttcctcgagcgatctggacccttcacacaccctgatttcgaaccgagcact
gaatctctccagtttttgttagatacatgtaaagtgctagtcattggagctggcggctta
ggatgtgagctcctcaaaaatctggcattgtctggttttagacagattcatgttatagac
atggacactattgatgtttccaatctaaataggcagtttttatttaggcctaaagatgtt
ggaagacctaaggctgaagttgctgcagaatttctaaatgacagagttcctaattgcaat
gtagttccacatttcaacaagattcaagacttcagtgacactttctatcgacaatttcat
attattgtttgtggactggactccattatagccagaagatggataaatggcatgctgata
tctcttctgaattatgaagatggtgtgttagatccaagctccatcatccctttgatagat
ggggggacagaaggctttaaaggaaatgcccgcgtgattctgcctggaatgactgcttgt
attgaatgtacgctggaactttatccaccacaggttaattttcccatgtgcaccattgca
tctatgccccggctaccagagcactgtattgagtatgtaaggatgttgcagtggcctaag
gaacagccttttggagaaggaattccattagatggagatgatcctgaacatattcagtgg
attttccaaaagtccttagagagagcatcacagtataatattaggggtgtcacatataga
ctcactcaaggagtagtaaaacgaatcattcctgcagtagcttccacaaatgcagtcata
gcagctgtgtgtgccactgaggtttttaaaatagccacaagtgcatacattcccctcaat
aattacttggtattcaatgatgtagatgggctatacacatacacatttgaagcagagaga
aaggaaaactgcccagcttgtagccagcttcctcaaaatattcagttttctccgtctgct
aaactacaggaagttttggattatctaaccaatagtgcttctctgcagatgaaatctcca
gccatcacagccacattagagggaaaaaatagaacactttacttacagtcagtaacttct
attgaagaaagaacaaggccaaatctttccaaaacattgaaagaattaggacttgttgat
ggacaagaactggcagttgctgatgtcaccacaccacagactgtattattcaagcttcat
ttcacttcttaa

DBGET integrated database retrieval system