KEGG   Oryctolagus cuniculus (rabbit): 100343513
Entry
100343513         CDS       T03373                                 
Symbol
CUL2
Name
(RefSeq) cullin 2
  KO
K03870  cullin 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04066  HIF-1 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05200  Pathways in cancer
ocu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100343513 (CUL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100343513 (CUL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100343513 (CUL2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100343513 (CUL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100343513 (CUL2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Cullin
     100343513 (CUL2)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Rio2_N
Other DBs
NCBI-GeneID: 100343513
NCBI-ProteinID: XP_017206205
Ensembl: ENSOCUG00000014729
UniProt: G1T810
LinkDB
Position
Un
AA seq 745 aa
MSLKPRVVDFDETWNKLLTTIRAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTE
TKVFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTE
ADLQYGYGGVDMNEPLMEIGELALDMWRRLMVEPLQAILIRMLLREIKSDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLHPSSYIKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVL
LRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKALTSVVNYREPKSVCRAPELLAKYCDSLLKKSAKGMTESEVEDRLTSFIT
AFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM
SVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMF
ELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSEAVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKD
TPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKK
CIEVLIDKQYIERSQASADEYSYVA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgtctttgaaaccaagagtggtagattttgatgaaacctggaacaagctgttaacgaca
atccgagcagttgtcatgttggagtacgtcgagagagcaacctggaacgatcgcttctca
gatatctatgctttatgtgtggcctatcctgaaccccttggagaaagactatatacggaa
actaaggtttttttggaaaatcatgttcggcatttgcacaagagagttctggagtctgag
gagcaagtgcttgtaatgtatcataggtattgggaagagtacagcaagggcgcagactat
atggactgcctgtacaggtatctcaacacccagttcattaaaaagaacaagttgacagaa
gctgacctgcagtatggctatggtggtgtggacatgaatgagcctctcatggagatagga
gagctggcactggacatgtggcggaggttgatggttgaacctcttcaggccatcctcatc
agaatgctgttgcgcgagatcaaaagcgatcgtggtggagaagacccaaaccagaaagta
atccatggggttattaactcctttgttcatgttgaacagtataagaaaaaattcccctta
aagttttatcaggaaatctttgagtctccgtttctgactgaaacaggagagtattacaag
caagaagcttcaaatttattacaagaatcaaactgctcgcagtatatggaaaaggttcta
ggtagattaaaagatgaagaaattcggtgtcgaaaatacttacatccaagctcctatatc
aaagtgatccatgaatgtcagcagcggatggtagcagaccacttgcagttcctgcatgcg
gaatgtcataacatcattcggcaagagaagaagaacgacatggcaaacatgtacgtctta
ctccgggctgtgtccactggtttacctcatatgattcaggagctgcaaaaccacatccat
gacgagggccttagagcaaccagcaacctcactcaggaaaacatgccaacactgtttgtg
gagtcagttttggaagtacatggtaaatttgtgcaactcatcaacactgttttgaacggt
gaccagcactttatgagtgcgttggataaggccctcacgtcggttgtcaactacagagaa
cccaagtctgtttgcagagctcctgagctgcttgctaagtactgtgacagtttactgaag
aagtcagcgaaagggatgacggagagtgaagtagaagacagactcaccagcttcattact
gctttcaaatacatcgacgataaggatgtcttccagaagttctacgcaagaatgctggcc
aaacgtttaattcatgggttatctatgtctatggattctgaagaagccatgatcaataaa
ttaaagcaagcctgtgggtatgagttcaccagcaagctccatcggatgtacacagacatg
agtgtcagtgctgacctcaacaataagttcaacaattttatcaaaaaccaagacaccgtg
atagatttggggattagctttcagatctacgtcctgcaggctggcgcatggccgctgact
caggctccgtcctccacgttcgcgattccccaggagctggagaagagcgtccagatgttt
gaattattctatagccaacatttcagtggaaggaaactcacatggttacattatctctgc
acaggtgaagtgaagatgaactatctgggcaaaccgtacgtcgccatggtgacgacctac
cagatggctgtcctcctcgcgtttaacaacagtgaagccgtcagctataaggagcttcag
gacagcactcagatgaacgagaaggagctgacaaaaacaatcaagtcgctgctcgacgtg
aaaatgatcaaccacgactcagagaaggaagacatcgatgcagaatcctcattttcatta
aacatgaacttcagcagtaagagaacaaagtttaaaatcaccacgtcgatgcagaaggac
actccacaggaaatggagcagacaagaagtgccgtcgatgaagaccggaagatgtatctg
caggctgctatagttcgaatcatgaaagcgcggaaggtgcttcggcacaacgccctcatc
caagaggtgatcagccagtcgagagccaggttcaatcccagcatcagcatgatcaagaag
tgcatcgaggtcctcatagacaagcagtacatcgagcgcagccaggcgtccgcggacgag
tacagctacgtcgcgtga

DBGET integrated database retrieval system