KEGG   Oryctolagus cuniculus (rabbit): 100343547
Entry
100343547         CDS       T03373                                 
Symbol
IL1RL2
Name
(RefSeq) interleukin 1 receptor like 2
  KO
K05172  interleukin 1 receptor-like 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100343547 (IL1RL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100343547 (IL1RL2)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL1 receptor family
   100343547 (IL1RL2)
SSDB
Motif
Pfam: TIR Ig_2 Ig_3 I-set ig V-set Ig_6 TIR_2 STALD
Other DBs
NCBI-GeneID: 100343547
NCBI-ProteinID: XP_008251429
LinkDB
Position
2:complement(90188284..90230004)
AA seq 551 aa
MGMRCLLVCGVSIALPLFVGADVCKEIGMQNETPSVGQPFAFNCTFPPITFGKVNVLWYK
NSRKIPVSQNVHSRIHQDHTWILFLPLAWEDSGIYKCVIEETDHCYRIHINLTVAKRSWC
DNSGTSVSTLSDEYKQILHVGQDDSLMCHLHFPKSCVLDSIKWYKDCKEIESERFISLGL
KLSVSNVSAGDRGNYACVARLTHLGKEYTVLNSITVNVTERVGNGGRIPKIIYPKNNSIE
VQLGSTLIVDCNITDTKENTNLRCWRVNNTLVDDYYSESKRVREGIEVPVSFQDHTFYTV
NITFLEVKMEDYGLPFVCHAGVSAAYIILTLPAPDFQAYLIGGLTALTVVMLSLVGVYNV
FKIDIVLWYRSTFHPNGTTEDGKLYDAYILYPKPQRDSQSHDVDTLVWKILPEVLERQCG
YKLFIFGRDEFPGQAVASVIDENIKLCRRLMVIVVPESPSFSMLKNMSEEQIAVYNALIQ
DGMKVILIELEKIEDYAAMPESIQYIKQKHGAIQWSGGFAEQSQAATAKFWKKVRYHMPP
KRYPHLPLSSR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggggatgcggtgcctgctggtctgcggggtgtccatcgcgcttccactttttgtcgga
gcagatgtgtgcaaggagattggtatgcagaacgagacaccttctgtgggccagcctttt
gcttttaattgcactttccctcccataacatttgggaaagtaaatgtgctgtggtataaa
aattctaggaaaatccctgtgtcccaaaatgtacattctcgaattcaccaggaccacacc
tggattctgtttctccccttggcatgggaggactcaggcatctacaaatgtgtcatagag
gagacagaccactgttacagaatacacataaacctgactgttgctaaaagatcttggtgt
gacaattccggaacgagtgtgtctactttgtcagacgagtacaaacaaatattacatgtt
ggacaggatgacagtctgatgtgtcacttgcactttccgaagagctgtgttttggattca
ataaagtggtataaggactgtaaagagattgaaagcgagcggtttatttctttgggactc
aagctttctgtgagcaatgtgtcggcaggggacagggggaactatgcctgcgtggccaga
ctgacacacctggggaaagagtacacggtgttaaacagcatcactgtgaacgtcacagaa
agagttggaaatggaggaagaattcctaaaatcatttatccaaaaaacaattcaattgaa
gtacaacttggctccacccttattgtggactgcaatataacggacacaaaggagaataca
aatctgcgatgctggagggtcaataacacattggtggacgattactacagtgaatccaag
cgggtcagagaaggaatcgaagtccctgtttcttttcaggatcatacgttttacacggtg
aacattacttttttggaagtgaaaatggaagactacggccttccctttgtatgtcatgct
ggagtatccgcagcatacattatattaacactgccagctccagattttcaggcttacttg
ataggggggcttacagccttgacagtggtgatgttgtccctcgtgggtgtctacaacgtt
tttaagattgacattgtactttggtacaggagtaccttccatcctaatgggaccactgaa
gatgggaagttgtatgatgcctacatcttgtaccccaagccacagagagacagccagagc
catgacgtggacaccttggtgtggaagatcctgccggaagtgctggagagacagtgtgga
tataagttatttatatttggcagagatgaattccctggacaagccgtggccagtgtcatt
gatgaaaacatcaaactgtgcaggaggctgatggtgattgtggtccctgagtctccgagc
tttagcatgttaaagaacatgtcggaagagcagatcgcagtctacaatgccctgatccag
gatgggatgaaggtcattctcattgagctggagaaaatcgaggactacgctgccatgccg
gagtcaattcagtacatcaaacagaagcatggggccatccagtggagtgggggcttcgcg
gagcagtcacaggcagccacggccaagttttggaagaaagtgaggtatcatatgccaccc
aaaaggtacccccatctccccctgtccagccgctga

DBGET integrated database retrieval system