KEGG   Oryctolagus cuniculus (rabbit): 100343840
Entry
100343840         CDS       T03373                                 
Symbol
CCL7
Name
(RefSeq) chemokine (C-C motif) ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100343840 (CCL7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100343840 (CCL7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100343840 (CCL7)
   04062 Chemokine signaling pathway
    100343840 (CCL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100343840 (CCL7)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100343840 (CCL7)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100343840
NCBI-ProteinID: NP_001284411
UniProt: J7I290
LinkDB
Position
19:23731547..23733738
AA seq 99 aa
MQISAALLCLLLTVAAFSSQVLAQPEGTNSGKTCCYRFHNRRMDPQKLRSYTLISISYCP
REAVIFKTKQHREVCADPKWPWAQNAIAYLNKKTQTSKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcaaatctctgcrgcacttctgtgcctgctgctcacagtggctgccttcagctcccag
gtgcttgcccagccagaagggactaacagcggcaaaacctgctgctacagattccacaac
aggaggatggacccgcagaagctgaggagctacacactcatcagcatcagctactgtccc
cgggaagctgtgatcttcaagaccaaacagcaccgagaggtctgtgctgaccccaagtgg
ccatgggcccaaaatgccattgcctacctgaacaagaaaactcagacttcaaagccttga

DBGET integrated database retrieval system