KEGG   Oryctolagus cuniculus (rabbit): 100343840
Entry
100343840         CDS       T03373                                 
Symbol
CCL7
Name
(RefSeq) chemokine (C-C motif) ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100343840 (CCL7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100343840 (CCL7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100343840 (CCL7)
   04062 Chemokine signaling pathway
    100343840 (CCL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100343840 (CCL7)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100343840 (CCL7)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100343840
NCBI-ProteinID: NP_001284411
UniProt: J7I290
LinkDB
Position
19:23731547..23733738
AA seq 99 aa
MQISAALLCLLLTVAAFSSQVLAQPEGTNSGKTCCYRFHNRRMDPQKLRSYTLISISYCP
REAVIFKTKQHREVCADPKWPWAQNAIAYLNKKTQTSKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcaaatctctgcrgcacttctgtgcctgctgctcacagtggctgccttcagctcccag
gtgcttgcccagccagaagggactaacagcggcaaaacctgctgctacagattccacaac
aggaggatggacccgcagaagctgaggagctacacactcatcagcatcagctactgtccc
cgggaagctgtgatcttcaagaccaaacagcaccgagaggtctgtgctgaccccaagtgg
ccatgggcccaaaatgccattgcctacctgaacaagaaaactcagacttcaaagccttga

KEGG   Oryctolagus cuniculus (rabbit): 100348266
Entry
100348266         CDS       T03373                                 
Symbol
CCL5
Name
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04668  TNF signaling pathway
ocu05020  Prion disease
ocu05142  Chagas disease
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100348266 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348266 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348266 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348266 (CCL5)
   04621 NOD-like receptor signaling pathway
    100348266 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    100348266 (CCL5)
   04062 Chemokine signaling pathway
    100348266 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100348266 (CCL5)
   05168 Herpes simplex virus 1 infection
    100348266 (CCL5)
   05163 Human cytomegalovirus infection
    100348266 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100348266 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100348266 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    100348266 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100348266 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348266 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348266 (CCL5)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348266 (CCL5)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100348266 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348266
NCBI-ProteinID: XP_017204526
Ensembl: ENSOCUG00000002848
UniProt: G1SIG1
LinkDB
Position
19:complement(24923608..24932154)
AA seq 91 aa
MEVSAAALAVLLTAAALCAPASASPYASDTTPCCFAYISRLLPRAHVTEYFYTSGKCSFP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaggtctccgccgccgccctcgccgtcctcctcaccgctgctgccctctgcgcacct
gcatctgcctccccatatgcctcggacaccacgccctgctgctttgcctacatctcccgc
ctgctgccccgggcccacgtcacggagtatttctataccagcggcaagtgctccttcccg
gcagttgtctttgtcaccaggaagaaccgccaggtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctaa

KEGG   Oryctolagus cuniculus (rabbit): 100348517
Entry
100348517         CDS       T03373                                 
Symbol
CCL14
Name
(RefSeq) C-C motif chemokine ligand 14
  KO
K21092  C-C motif chemokine 14
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348517 (CCL14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348517 (CCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100348517 (CCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348517 (CCL14)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348517 (CCL14)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348517
NCBI-ProteinID: XP_002719291
Ensembl: ENSOCUG00000002849
UniProt: G1TNR8
LinkDB
Position
19:complement(24962125..24964790)
AA seq 94 aa
MKVSVAAIPLLLLFITPIALGSRAEFSPRGPYHPAECCFSYITRVVPRQRITDYYETSSE
CSKPGIVFITKKGYSICANPRDDWVQDYIRDLEK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccatccccctcctcctcctcttcatcacccccatcgcccta
ggatcccgggctgaattctccccacgaggcccctaccaccccgccgagtgctgcttctcc
tacatcacccgcgttgtcccccgtcagcggattacagattactacgagaccagcagcgag
tgctccaagcccggaattgtcttcatcaccaaaaagggctactcaatctgcgccaacccc
cgggatgactgggtccaggactacatcagggacctggagaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100348776
Entry
100348776         CDS       T03373                                 
Symbol
CCL3
Name
(RefSeq) C-C motif chemokine 3-like 1
  KO
K05408  C-C motif chemokine 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu05142  Chagas disease
ocu05163  Human cytomegalovirus infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348776 (CCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348776 (CCL3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348776 (CCL3)
   04062 Chemokine signaling pathway
    100348776 (CCL3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100348776 (CCL3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100348776 (CCL3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100348776 (CCL3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100348776 (CCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348776 (CCL3)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348776 (CCL3)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348776 (CCL3)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100348776 (CCL3)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348776
NCBI-ProteinID: XP_002719292
Ensembl: ENSOCUG00000000771
UniProt: G1SE13
LinkDB
Position
19:complement(25033918..25036115)
AA seq 93 aa
MKVSGVALAVLLCAMALSTQVFSIPLGADTPTACCFSYISRQIPYKFIADYFETSSQCSK
PGVIFLTKRGRQVCADISEAWVQGYINDLELNS
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaaggtctccggggttgccctcgccgtcctcctgtgcgccatggctctcagcacccag
gtcttctccataccacttggtgccgacaccccgaccgcctgctgcttctcctacatctcc
cgccagatcccctacaaattcatagccgactattttgagaccagcagccagtgctccaag
ccaggcgtcattttcctaaccaagagaggccggcaggtgtgcgctgacatcagtgaggcc
tgggtccagggctacatcaatgacctggaactgaattcctaa

KEGG   Oryctolagus cuniculus (rabbit): 103351522
Entry
103351522         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 23
  KO
K05511  C-C motif chemokine 15/23
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351522
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351522
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351522
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351522
SSDB
Motif
Pfam: IL8 MC3 ESF1
Other DBs
NCBI-GeneID: 103351522
NCBI-ProteinID: XP_008269360
Ensembl: ENSOCUG00000000686
LinkDB
Position
19:complement(24980990..24987111)
AA seq 125 aa
MKVSVAALSFLALILAAALGSQALVTHDTDTKQLALVVDRFDKEIVQGFHRPTDCCFSYT
KRNIQCFLMQDYIETSSQCSMPAVIFLTKRGQKVCADSSDERVRKCVSSLQRDLPTRNLG
IVALA
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctccttcctcgccctcatccttgcagctgccctgggc
tcgcaggccctggtcacacatgatacagacacaaaacagctcgccttggtggtggataga
tttgataaagaaatcgtccaaggcttccaccgccctacagactgctgcttctcctacaca
aaacgaaacatccagtgcttcctcatgcaagattatattgagaccagcagtcagtgctcc
atgccagctgtcatcttcctcaccaagaggggacaaaaagtgtgtgctgactccagtgat
gagagagtccggaagtgtgtgtcaagcctgcaaagggacctgccgaccaggaatctagga
atagtggcactggcttga

KEGG   Oryctolagus cuniculus (rabbit): 103351523
Entry
103351523         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 15
  KO
K05511  C-C motif chemokine 15/23
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351523
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351523
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351523
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351523
SSDB
Motif
Pfam: IL8 Chlam_OMP3
Other DBs
NCBI-GeneID: 103351523
NCBI-ProteinID: XP_008269362
Ensembl: ENSOCUG00000029281
LinkDB
Position
19:complement(24971837..24977356)
AA seq 138 aa
MKLSTAALSLLLLAAVLGTQAFVLHNTETRQLTRAMDRLINRRPIQGVNPIQSIMPLSSN
VRPSDCCYGYTTRPLQCSVMEDFFETNSQCSMPAVIFITKCGKLICANPRNNEVEECMET
LKTQGTRLGPRAAAGLLY
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaagctctccacggctgccctctccctcctcctccttgctgctgtccttggcacccag
gccttcgtcttgcacaatacagagacgagacagctcaccagggcgatggacaggcttatt
aatagaagacccatccaaggtgtaaaccctatacaatcaatcatgcctctatcttcaaat
gtgcgtcctagtgactgctgctatggctacaccacacgacccctccagtgttcagttatg
gaagatttctttgagaccaacagtcagtgctccatgccagctgtcatcttcatcactaaa
tgtggaaaactgatctgtgccaaccccagaaataatgaagttgaagaatgcatggaaacc
ctgaagacccagggaaccagattaggccccagggcagcagcagggttgctttactaa

KEGG   Oryctolagus cuniculus (rabbit): 103351619
Entry
103351619         CDS       T03373                                 
Symbol
CCL16
Name
(RefSeq) C-C motif chemokine 16
  KO
K21093  C-C motif chemokine 16
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351619 (CCL16)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351619 (CCL16)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351619 (CCL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351619 (CCL16)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351619 (CCL16)
SSDB
Other DBs
NCBI-GeneID: 103351619
NCBI-ProteinID: XP_008270002
LinkDB
Position
19:complement(24957002..24957617)
AA seq 121 aa
MEVGSHGLPPCSPSSNVMIAKIPDGVDYPPHXCLKFHEKALPGKLVPGSRRALSCHLPVS
YGVAADVCQHKNLEVCTNSEDTRAQEHLQDPWPPLLPARTPALVKTIGSERGQPQPQPLF
H
NT seq 366 nt   +upstreamnt  +downstreamnt
atggaggtaggcagccatggtctgcctccctgctccccatcatccaatgtgatgattgca
aaaattcctgacggggtagactatccaccccactgatgcctgaagttccatgagaaagca
ttgccggggaaactggtgccaggatccagaagggccctcagctgccacttgccagtgagc
tatggagtagcggctgacgtttgtcaacataaaaacctggaggtctgcaccaactctgaa
gacacccgggcccaagagcacctccaggatccctggccacctctgctgcctgccagaacc
ccagccctggttaaaaccatcggatcagagaggggacagccccagccccagcccctcttc
cattag

DBGET integrated database retrieval system