Oryctolagus cuniculus (rabbit): 100343903 Help Entry 100343903         CDS       T03373                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04613   Neutrophil extracellular trap formation ocu05034   Alcoholism ocu05203   Viral carcinogenesis ocu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ocu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100343903  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100343903   09163 Immune disease    05322 Systemic lupus erythematosus     100343903   09165 Substance dependence    05034 Alcoholism     100343903  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ocu03036]     100343903 Chromosome and associated proteins [BR:ocu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100343903 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  100343903 NCBI-ProteinID:  XP_051710997 Ensembl:  ENSOCUG00000033864 LinkDB All DBs Position 12:144909324..144912024 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggcctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccgccgcctggcccgg cgcggcggcgtcaagcgcatctcggggctcatctacgaggagacccgcggcgtgctcaag gtcttcctcgagaacgtcatccgcgacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggacgcacgctctacggc ttcggcggctga

DBGET integrated database retrieval system