KEGG   Oryctolagus cuniculus (rabbit): 100344048
Entry
100344048         CDS       T03373                                 
Symbol
IL1R2
Name
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04640  Hematopoietic cell lineage
ocu05146  Amoebiasis
ocu05166  Human T-cell leukemia virus 1 infection
ocu05202  Transcriptional misregulation in cancer
ocu05215  Prostate cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100344048 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100344048 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100344048 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100344048 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100344048 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100344048 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100344048 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100344048 (IL1R2)
   04090 CD molecules [BR:ocu04090]
    100344048 (IL1R2)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL1 receptor family
   100344048 (IL1R2)
CD molecules [BR:ocu04090]
 Proteins
  100344048 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set V-set Ig_6 Ig_5 Izumo-Ig
Other DBs
NCBI-GeneID: 100344048
NCBI-ProteinID: XP_008251471
Ensembl: ENSOCUG00000016746
UniProt: G1TCA1
LinkDB
Position
2:complement(90431285..90467268)
AA seq 425 aa
MQSCRQRWAGPKRSTSCVPWGLPGAMFILYTFMMSVFAFAIQPEAHTGHCPYRGKHFKVE
FRLEGELVVLRCPQMWSWAGISVDPHVNLTWRRNGSAQLVPAEEARMRVEDGKLWLLPAL
QSDSGTYICTVRNASYCGEMSTELRVFENTEASLPFISYPQILTLSTSGRLVCPDLGEFA
RNKTDVKIQWYKDSVLLDQDNKKFISVTGTSHLVIQDVAMEDAGYYMCAFTFSHGGKQYN
VTRNIELRIKQRIEETIPVIISPRQTISASLGSRLTIPCKVFLGAGTPLSTMLWWKANNT
HVDSAYQGGRVTEGPRQEYSENNENYIEVPLIFNPVTREDLNTDFKCVVRNTLSVQTLHT
TVREASSSFSWEIALAPLTLVFLVLGGLWMHRRCKRRAGKAYGLTMLKTGCQEFPAYPST
IKEMI
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcagagctgcaggcaacggtgggctggacctaagcgctctacttcctgtgtcccctgg
gggctgccaggagccatgttcatcttgtacacgttcatgatgagtgtttttgcctttgcc
attcagccagaggcgcacacaggacactgcccatatcgtggcaagcatttcaaagtggaa
ttcaggctggaaggggagctggtggtcctaaggtgcccccagatgtggtcctgggcaggg
atttctgtcgacccccacgtcaacctgacctggcgtagaaacggttctgctcagctggtt
ccggcagaagaggcacggatgcgggtggaggacggcaagctctggctcctgcctgccttg
cagagcgactctggaacctacatctgcactgtcagaaacgcctcctactgtggtgaaatg
tccacggagctcagggtttttgaaaacacggaagcatccctgccgttcatctcctaccca
cagattctaaccttgtcaacttctgggagattagtgtgccctgatttaggggaattcgcc
cgtaacaaaactgatgtgaagattcaatggtacaaggattctgtccttttggatcaagac
aataagaaatttataagtgtgacagggacatctcacttagtcatccaggatgtggccatg
gaggatgcgggctactacatgtgtgccttcacattttcccatggaggaaagcagtacaac
gtcactaggaatattgaactgcgtatcaagcaaagaatagaagagaccattcccgtgatt
atctccccccgccagaccatatcagcttctctggggtcaagactgacaatcccatgtaag
gtgtttctgggagctggcacacccttgagcaccatgctgtggtggaaggccaacaacacc
catgtggacagcgcctaccaggggggccgtgtgaccgagggaccacgccaggaatattcc
gaaaataatgagaactacatcgaagtgccattgattttcaatccagtcaccagagaagat
ctgaacacggattttaagtgtgtggtccggaatacgttgagtgttcagacactacacacc
acagtcagagaagcctcttcctcgttctcctgggagattgcactggcccccctgacgctg
gtcttcttggtgttggggggactatggatgcacaggcggtgcaaacgcagagctggaaaa
gcatatggtctgactatgctgaagactggctgccaagaatttccagcctacccaagtaca
ataaaggaaatgatttaa

DBGET integrated database retrieval system