KEGG   Oryctolagus cuniculus (rabbit): 100344077
Entry
100344077         CDS       T03373                                 
Symbol
IL22RA1
Name
(RefSeq) interleukin 22 receptor subunit alpha 1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344077 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100344077 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100344077 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100344077 (IL22RA1)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL10/28 receptor family
   100344077 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100344077
NCBI-ProteinID: XP_002716023
Ensembl: ENSOCUG00000006743
LinkDB
Position
13:129209651..129230728
AA seq 588 aa
MRTLLTILTVGSLAAHLAEQRSDLLQHVKFQSSNFENILTWDSGPESTPDTVYSVEYKTY
GEREWLAKAGCQRITRRSCNLTVETGNLTEHYYARVTAVGAGGWTDTKMTRRFSSLQHTA
IKPADVTCIPKVRSIQVVIHPAPTPIHAGDGHQLTLEDIFHDLFYRVELRVNHTYQMHLG
GKQREYEFFGLTPDTEFLGSITIFVPTWSKESNPYVCRVKTLPDRTWVYSFLGAIVFLMG
FLMAVFCCLSYRYVTKPPAPPNSLNVQRVLTFQPLHSIQERVLVPVFDLGGPSSPGSLVQ
PVQYSQIKGLGPQEPPGAAQLHSPPGMVYVEQSDSSVLRPSDATPPQTRSTRLPCAPKAT
PEVPPPSYTPQVTPKAKPPTYAPQAIPKAQPSSYAPQAAADSWLPSYGVCVADSGKDLPP
AALAGPQHLWPRSQIPEEAPAGSSIPEGLSLQEVTSLISSAVEDPREDSPFHPPLGVCKD
RERDLGVLHSEGPGIPGFLRNDLPLLSSVQIEGHPAPLLLNTPSPPCSPSEHGPSLWGLL
DSVVCPKDDSVGSEAEAKGSAPRAPGLEPPTELDSLFRGLALTVQWES
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgaggacactactgaccatcttgaccgtgggatccctggctgcacacctcgcggagcag
cgctcggatctgcttcagcacgtgaaattccagtccagcaacttcgaaaacatcctgacg
tgggacagcggcccagagagcacgccagacactgtctacagcgtggagtataagacgtac
ggagagagggagtggctggcgaaggcgggctgccagcggatcacccggagatcctgcaac
ctgaccgtggagacgggcaacctcacggagcactactacgccagggtcacagccgtgggc
gcggggggctggactgacaccaagatgaccaggcggttcagctctctgcagcacactgcc
atcaaaccagcagatgtgacctgtatccccaaggtcaggtccattcaggtggtcatccac
cctgcccccacgcccatccatgcaggggatggccaccagctaacgctggaggacatcttc
cacgacctgttctaccgcgtggagctccgtgtcaaccacacctaccaaatgcaccttgga
gggaagcagagagaatacgagttctttggcctgacgcctgacacggagttcctcggctcc
atcacgatctttgtgcccacctggtccaaggagagtaacccctatgtgtgccgagtgaag
acgctgccagatcggacctgggtctactccttcctgggcgccatcgtgttcctcatgggc
ttcctgatggcggtgttctgctgcctgagctacagatacgtcaccaagccgccggcacct
cccaactcgctgaacgtccagcgagtcctgaccttccagccgttacactccatccaggag
cgcgtcctggtccccgtctttgacctcggcggccccagcagccccggcagcctggtccag
cctgtccagtactcccagatcaagggtctggggccgcaggagcccccaggagccgcacag
ctgcacagcccgcccgggatggtctacgtagagcagtcggacagctccgtcctcaggccc
tccgacgccacgcctccccagacacgctccaccaggctaccctgtgcccccaaggcgacc
cctgaggtcccaccaccatcctacacaccccaagtaacccccaaagcaaagccgcccacc
tatgccccacaggccatccctaaggctcagccctcctcctatgccccgcaagccgcggcc
gacagctggcttccttcctatggcgtgtgcgtggctgactccggcaaagacctgccccct
gcggcactcgctggtccccagcacctctggcccaggagtcagatcccggaagaggcgcca
gcaggaagctccatcccagagggcctttctctgcaggaagtgacctccttgatctcctca
gccgtggaggaccccagagaagacagccccttccacccgcccctgggagtttgcaaggac
agagaacgtgacctgggcgtgctgcacagcgagggaccggggatcccagggttcctcagg
aatgatctcccactcctctcctcggtccagatcgaaggccaccccgcacccctgcttttg
aacaccccttcccctccctgttccccctcagaacacggcccaagtctctggggcctgctg
gactctgtggtgtgtcccaaggatgacagtgtagggtccgaggctgaagccaagggctca
gcccccagggccccgggcctggagccgcccacagagctggactcactattcaggggcctg
gccctgaccgtgcagtgggagtcctga

DBGET integrated database retrieval system