KEGG   Oryctolagus cuniculus (rabbit): 100344135
Entry
100344135         CDS       T03373                                 
Symbol
EHD3
Name
(RefSeq) EH domain containing 3
  KO
K12476  EH domain-containing protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100344135 (EHD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100344135 (EHD3)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100344135 (EHD3)
SSDB
Motif
Pfam: DUF5600 EF-hand_4 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 GTP_EFTU Gtr1_RagA AIG1 AAA_28 AAA_16 TsaE EF-hand_5
Other DBs
NCBI-GeneID: 100344135
NCBI-ProteinID: XP_002709978
Ensembl: ENSOCUG00000001228
UniProt: G1SF06
LinkDB
Position
2:complement(154835879..154863883)
AA seq 535 aa
MFSWLGTDDRRRKDPEVFQTVSEGLKKLYKTKLLPLEEHYRFHEFHSPALEDADFDNKPM
VLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDVEGIIPGNALVVDPKK
PFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAE
RVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSL
GKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKR
ARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQ
DQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEETQRPVQMVKGGAFEGTLHG
PFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSV
LGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVAD
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgttcagctggctggggaccgacgatcgccggaggaaggaccctgaggtcttccagacg
gtgagcgaggggctcaagaaactctacaagaccaagctgttgcccctggaagagcattac
cgcttccatgagttccactcgccggccctggaggacgccgacttcgacaacaagcccatg
gtcctgctggtgggccagtactccaccgggaagaccaccttcatcaggtacctgctggaa
caggatttccccggcatgaggatcggtcccgagccgaccactgactccttcatcgcggtg
atgcagggcgatgtggagggcatcatcccgggcaacgccctggtggtggaccccaagaaa
cccttccggaaactcaacgccttcggcaacgccttcctgaacaggttcgtgtgtgcccag
ctgcccaatcccgtgctggagagcatcagcgtcatcgacacgccggggatcctgtccggg
gagaagcagaggatcagccgaggctacgacttcgcagctgtcctcgagtggtttgccgag
cgtgtggaccgcatcatcctgctcttcgacgcccacaagctggacatctccgacgagttc
tcggaggtcatcaaggccctcaagaaccatgaggacaagatgcgggtggtgctgaacaag
gcggaccagatcgagacgcagcagctgatgcgcgtctacggcgccctcatgtggtcactg
ggcaagatcgtgaacacacccgaggtgatccgggtctacatcggctccttctggtcccac
ccgctgctcatccccgacaaccgcaagctcttcgaggctgaggagcaggacctgttcagg
gacatccagagtctgccccgaaatgctgcgctgcgcaagctcaatgacctcatcaagaga
gccaggctggccaaggtgcacgcctacatcatcagctccctgaagaaggagatgccctca
gtgttcgggaaggacaacaagaagaaggagctggtgaacaacctggctgagatttacggc
cgcattgagcgggagcatcagatctcgcctggagacttcccgaacctcaagcggatgcag
gaccagctccaggcccaggacttcagcaaattccagccgctaaagagcaagctcctggag
gtggtggatgacatgctggcgcacgacattgcccagctcatggtgctggtgcgccaggag
gagacccagcggcccgtccagatggtgaagggaggagcgttcgagggcaccctgcacggc
cccttcgggcatggctacggggaaggggctggggagggcatcgacgatgcggagtgggtg
gtggccagggacaagcccatgtacgacgagatcttctacaccctgtccccggtggacggc
aagatcacaggcgctaatgcgaagaaggagatggtgcgctccaagctgcccaacagtgtg
ctgggcaagatctggaagctggcagacattgacaaggacggcatgctggatgacgaggag
ttcgccctggccaaccacctcatcaaagtcaagctggaggggcacgagctgcccaacgag
ctgcccgcccacctcctgcccccctccaagaggaaagtcgctgactga

DBGET integrated database retrieval system