Oryctolagus cuniculus (rabbit): 100344147 Help Entry 100344147         CDS       T03373                                  Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04022   cGMP-PKG signaling pathway ocu04081   Hormone signaling ocu04270   Vascular smooth muscle contraction ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     100344147   09133 Signaling molecules and interaction    04081 Hormone signaling     100344147  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     100344147  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100344147  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ocu04052]     100344147 Cytokines and neuropeptides [BR:ocu04052]  Neuropeptides   Unclassified    100344147 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP DUF1180 Motif Other DBs NCBI-GeneID:  100344147 NCBI-ProteinID:  XP_002712569 LinkDB All DBs Position 7:363337..367667 Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAAPKAPRNPPGEEVPEPQTAGGGQKKGDKAPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGTNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctgctttcgctccggccc tccgaagccaagccgggggcggcgccgaaggccccacggaacccgcctggggaggaggtg cccgagccccagactgcaggcggcgggcagaagaagggcgacaaggctcccgggggcgga ggcgccaacctcaagggcgaccgatcgcgactgctgcgggacctgcgtgtggacaccaag tcgcgggcggcgtgggcccgccttctgcacgagcaccccaacgcccgcaaatacaaaggg accaacaagaagggcttgtccaagggctgctttggcctcaaactggaccggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system