KEGG   Oryctolagus cuniculus (rabbit): 100344187
Entry
100344187         CDS       T03373                                 
Symbol
TKFC, DAK
Name
(RefSeq) triokinase and FMN cyclase
  KO
K00863  triose/dihydroxyacetone kinase / FAD-AMP lyase (cyclizing) [EC:2.7.1.28 2.7.1.29 4.6.1.15]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00051  Fructose and mannose metabolism
ocu00561  Glycerolipid metabolism
ocu01100  Metabolic pathways
ocu01200  Carbon metabolism
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100344187 (TKFC)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100344187 (TKFC)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100344187 (TKFC)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.28  triokinase
     100344187 (TKFC)
    2.7.1.29  glycerone kinase
     100344187 (TKFC)
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.15  FAD-AMP lyase (cyclizing)
     100344187 (TKFC)
SSDB
Motif
Pfam: Dak1 Dak2
Other DBs
NCBI-GeneID: 100344187
NCBI-ProteinID: XP_008272642
Ensembl: ENSOCUG00000001673
UniProt: G1SFW1
LinkDB
Position
Un
AA seq 578 aa
MASKKLVNSVAGCADDALAGLVACDPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHE
PAHAGFIGKGMLTGVIAGAVFTSPAVGSILAAIRAVAQAGTAGILLIVKNYTGDRLNFGL
AREQARAEGIAVEMVVIGDDSAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEITRR
VSEVAKTMGTLGVSLSSCSVPGSKPTFELAADEVELGLGIHGEAGVRRIKMATAEEIVRL
MLDHMTSTSNASHVPVQSGSSVVLMVNNLGGLSFLELGIIADAAVRCLEGRGVKIARALV
GTFMSALEMPGVSLTLLLVDEPLLKLIDAETAAAAWPNVARVSVTGRKRSRAAPVEPQEA
PDSTAAGGVTSKKMGLVLERVCTTLLGLEDHLNALDRAAGDGDCGATHSRAARAIQGWLK
EGPLPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTDLPAWSAAMDAGLE
AMQKYGQAAPGDRTMLDSLWAARKELQAWKNPGADLFQVLTKAVKSAEAAAEATKNMEAG
AGRASYISSARLEQPDPGAVAAAAILRAILEVLQSEDA
NT seq 1737 nt   +upstreamnt  +downstreamnt
atggcctccaagaagctggtgaactccgtggcaggctgtgccgatgatgcccttgctggc
ctggtggcctgcgaccccaacttacagcttctgcagggccaccgtgtggccctccgttct
gacctggacagcctcaagggccgggtggcactcctgtcaggcgggggctcgggtcatgag
cctgcacacgctggtttcatagggaaggggatgctgacaggagtcatcgctggcgccgtg
ttcacctccccagccgtgggcagcatcctggcagccatcagggctgtggcccaggcaggc
acagcggggatcctcctcattgtgaagaactacactggggaccggctcaactttggcctg
gcccgggagcaggccagggccgagggcatcgccgtagagatggtggtcatcggggacgac
agtgccttcaccgtgctaaagaaggcaggccggcgggggctctgtggcaccgtgctcatc
cacaaggtggctggtgccctggctgaggcaggggtggggctggaggagatcaccaggcgg
gtgagcgaggtcgccaagaccatgggtaccctgggggtgagcttgtcctcctgcagcgtc
ccaggctccaaacccacctttgagcttgcagctgatgaggttgagctgggcctaggaatc
catggggaagctggtgtgcgcaggataaagatggccactgcagaggagattgtgaggctc
atgctcgaccacatgacaagcacctccaatgcatcccatgtgcctgtgcagtcaggctcc
tcagtggtgctgatggtcaacaatctgggaggcctgtcattcctggaactgggcatcatc
gctgatgctgctgtccgctgtctagagggccgtggggtgaagatcgcccgtgccctggtg
ggcacctttatgtcagcgctggagatgcctggcgtttccctcactctcctgctggtggat
gagcccctcctgaaactgatagatgctgagactgccgcagcagcctggcctaatgtggcc
agggtctctgtgactgggcggaagcggagccgggcagcccctgtggagccccaggaggcc
cctgactccactgctgcaggaggtgtaacatccaagaagatgggacttgtgctggaacgg
gtgtgcaccaccctcctgggcctagaggaccacctgaatgccctggaccgggctgctggt
gatggggactgtggcgccacccacagtcgggctgccagagcgatccaggggtggctgaag
gagggtcccctgcctgccagccctgcccagcttctctccaagttgtccgtcctgcttctg
gagaagatgggaggctcatctggggcactctatggcctgttcctgactgcagctgcccag
cccctcaaagccaagactgacctcccagcctggtctgctgccatggatgccggcctggag
gccatgcagaagtatggacaggctgcaccaggggacaggacaatgctggattctctgtgg
gcagcgcgaaaggagctccaagcctggaagaacccaggggccgacctgttccaagtcctg
accaaagcagtcaagagtgctgaagctgcagctgaggccaccaagaatatggaagccgga
gccggacgagccagttacatcagctctgcgcggctggagcagccagaccccggggccgtg
gcagcagccgccatcctccgtgccatcctggaggtcttgcagagtgaggatgcatga

DBGET integrated database retrieval system