KEGG   Oryctolagus cuniculus (rabbit): 100344222
Entry
100344222         CDS       T03373                                 
Symbol
WWP2
Name
(RefSeq) WW domain containing E3 ubiquitin protein ligase 2
  KO
K05630  NEDD4-like E3 ubiquitin-protein ligase WWP2 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100344222 (WWP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100344222 (WWP2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100344222 (WWP2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100344222 (WWP2)
SSDB
Motif
Pfam: HECT WW
Other DBs
NCBI-GeneID: 100344222
NCBI-ProteinID: XP_002711715
Ensembl: ENSOCUG00000010764
UniProt: G1SZX9
LinkDB
Position
5:25186569..25344107
AA seq 868 aa
MASASASRAAAAPPFEKSQLTLKVVSAKPKVHHRQPRINSYVEVAVDGLPGETKKTGKRI
GSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSSVLKNNGGKMENTQLT
LNLQTENKGSVVSGGELTIFLDGPTVDLGSVPNGSAVTDGSQPPSRESSGTAVAPDNRHQ
PPSTNCFGGRSRTHRHSGGSARTATAPGEQSPSTRNRHRQPVKNPSHDGLANGTVNDEPT
AATDPEEPVVGVTSPPSAALSVTPSPNTTSLPAPATPAEGEEPSTSGTQVPAAAQAPDAL
PAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPT
AEYVRSYEQWQSQRSQLQGAMQHFSQRFLYQSSSASIDHDPLGPLPPGWEKRQDNGRVYY
VNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESG
TKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRR
RLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHL
TYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKENN
LEECGLELYFIQDMEILGKVTTHELKAGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTK
AFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDLSDWQKNTVYRHYAKSSKQVQWFWQV
VKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFNRL
DLPPYKSYEQLKEKLLYAVEETEGFGQE
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggcatccgccagcgccagccgggcagcagcggccccgccttttgagaagtctcagctc
actctgaaagtggtgtcagcaaagcccaaggtgcatcatcggcagccccggattaactca
tatgtggaagtggctgtggacggactccctggtgagaccaagaagaccgggaagcgcatt
gggagctctgagctgctctggaatgagatcatcattttgaatgtcacggctcagagccat
ttagacttgaaggtctggagctgccataccttgagaaatgaactgctgggcactgcctct
gtcaacctctccagtgtcctgaagaacaatgggggcaaaatggagaacacgcagctgact
ttgaacctgcagacggagaacaaaggcagcgttgtgtcgggtggagagctgacaattttc
ctggacgggccgactgttgatctgggaagtgtgcctaatggcagtgccgtgactgacgga
tcgcagccgccttcgagggaatccagtgggaccgctgtagcaccagacaaccggcaccag
ccccccagcacaaactgctttggcgggagatcccggacgcacagacattcaggtggttca
gccagaacagccacagcgcctggcgagcaaagccccagtacgaggaaccggcaccgccaa
ccggtcaagaacccaagccacgatggcctggccaatggcacagtgaatgacgagcccact
gcagccactgatcccgaagaacctgttgttggtgtgacgtccccaccttctgcagccctg
agtgtgaccccgagcccaaacaccacgtccctgcctgccccagccaccccagctgaagga
gaggaacccagtacctcgggtacacaggtgccagcagctgcgcaggcccccgatgctctg
cctgccgggtgggagcagcgagagctgcccaacgggcgtgtctattatgttgaccacaat
accaagactaccacctgggagcggcctcttcctccaggctgggaaaaacgcacagacccc
cgaggcaggttttactacgtggatcacaacacacggaccaccacgtggcagcgccccaca
gcagagtatgtgcggagctacgagcagtggcagtctcagcgcagtcagctccagggggcc
atgcagcacttcagccaaagattcctctaccagtcttcgagcgcttcgattgaccatgat
cccctgggccccctccctcctggctgggagaagagacaggacaatggccgggtgtattac
gtgaaccataatacacgcacgacccagtgggaagaccctcggacccaggggatgatccag
gagccggcactgccgccgggctgggagatgaagtataccagcgagggcgtgcggtacttc
gtggaccacaacacccgcaccaccacctttaaggatcctcggccagggtttgagtcgggg
acgaagcaaggctcccctggtgcctatgaccgaagcttccggtggaagtatcaccagttc
cgcttcctctgccactccaatgccctgcccagccacgtgaagatcagcgtctccaggcag
accctttttgaggattctttccagcagatcatgaacatgaagccctacgacctgcgccgc
cggctctacatcatcatgcgtggcgaggagggcctggactacggaggcatcgccagagag
tggtttttcctcctgtcccacgaggtgctcaacccgatgtattgtctgtttgaatacgct
gggaagaacaactactgcctgcagatcaaccccgcctcctccatcaaccctgaccacctc
acctacttccgctttattggcaggttcattgccatggccctgtaccatgggaagttcatt
gacacaggcttcaccctccccttctataagcggatgctcaacaagagacccaccctgaag
gacctggagtccatcgaccccgagttctacaactctatcgtgtggatcaaagagaacaac
ctggaagagtgtggcctggagctgtacttcatccaggacatggagatcctgggcaaggtg
acgacgcacgagctgaaggccggcggggagagcatccgcgtcaccgaggagaacaaggag
gagtacatcatgctgctgaccgactggcgcttcacccgcggcgtggaagagcagaccaaa
gccttcctggatggcttcaacgaggtagcccctctggaatggctgcgctactttgatgag
aaagagctggagctgatgctgtgcggcatgcaggagatagacctgagcgactggcagaag
aacaccgtgtaccggcactacgccaagagcagcaagcaggtccagtggttctggcaggtg
gtgaaggagatggacaatgagaagaggatccgcctgctacagtttgtgaccggaacctgc
cgcctgcctgttgggggattcgccgagctcatcggcagcaacggaccccagaagttctgc
atcgacaaggttggcaaggaaacctggctgcccagaagccatacctgcttcaaccggctg
gatctgcccccgtacaagagctacgagcagctgaaggagaagctgttgtatgccgtcgag
gagaccgagggcttcggacaggagtga

DBGET integrated database retrieval system