Oryctolagus cuniculus (rabbit): 100344241 Help Entry 100344241         CDS       T03373                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04062   Chemokine signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04211   Longevity regulating pathway ocu04213   Longevity regulating pathway - multiple species ocu04218   Cellular senescence ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04371   Apelin signaling pathway ocu04540   Gap junction ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04625   C-type lectin receptor signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04714   Thermogenesis ocu04720   Long-term potentiation ocu04722   Neurotrophin signaling pathway ocu04725   Cholinergic synapse ocu04726   Serotonergic synapse ocu04730   Long-term depression ocu04810   Regulation of actin cytoskeleton ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04915   Estrogen signaling pathway ocu04916   Melanogenesis ocu04917   Prolactin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04926   Relaxin signaling pathway ocu04929   GnRH secretion ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu05010   Alzheimer disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05034   Alcoholism ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05213   Endometrial cancer ocu05214   Glioma ocu05215   Prostate cancer ocu05216   Thyroid cancer ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05221   Acute myeloid leukemia ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05230   Central carbon metabolism in cancer ocu05231   Choline metabolism in cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100344241    04012 ErbB signaling pathway     100344241    04014 Ras signaling pathway     100344241    04015 Rap1 signaling pathway     100344241    04370 VEGF signaling pathway     100344241    04371 Apelin signaling pathway     100344241    04068 FoxO signaling pathway     100344241    04072 Phospholipase D signaling pathway     100344241    04071 Sphingolipid signaling pathway     100344241    04151 PI3K-Akt signaling pathway     100344241    04150 mTOR signaling pathway     100344241  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100344241    04137 Mitophagy - animal     100344241   09143 Cell growth and death    04210 Apoptosis     100344241    04218 Cellular senescence     100344241   09144 Cellular community - eukaryotes    04540 Gap junction     100344241    04550 Signaling pathways regulating pluripotency of stem cells     100344241   09142 Cell motility    04810 Regulation of actin cytoskeleton     100344241  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100344241    04650 Natural killer cell mediated cytotoxicity     100344241    04660 T cell receptor signaling pathway     100344241    04662 B cell receptor signaling pathway     100344241    04664 Fc epsilon RI signaling pathway     100344241    04062 Chemokine signaling pathway     100344241   09152 Endocrine system    04910 Insulin signaling pathway     100344241    04929 GnRH secretion     100344241    04912 GnRH signaling pathway     100344241    04915 Estrogen signaling pathway     100344241    04917 Prolactin signaling pathway     100344241    04921 Oxytocin signaling pathway     100344241    04926 Relaxin signaling pathway     100344241    04935 Growth hormone synthesis, secretion and action     100344241    04919 Thyroid hormone signaling pathway     100344241    04916 Melanogenesis     100344241   09156 Nervous system    04725 Cholinergic synapse     100344241    04726 Serotonergic synapse     100344241    04720 Long-term potentiation     100344241    04730 Long-term depression     100344241    04722 Neurotrophin signaling pathway     100344241   09158 Development and regeneration    04360 Axon guidance     100344241   09149 Aging    04211 Longevity regulating pathway     100344241    04213 Longevity regulating pathway - multiple species     100344241   09159 Environmental adaptation    04714 Thermogenesis     100344241  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100344241    05206 MicroRNAs in cancer     100344241    05205 Proteoglycans in cancer     100344241    05207 Chemical carcinogenesis - receptor activation     100344241    05208 Chemical carcinogenesis - reactive oxygen species     100344241    05203 Viral carcinogenesis     100344241    05230 Central carbon metabolism in cancer     100344241    05231 Choline metabolism in cancer     100344241    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100344241   09162 Cancer: specific types    05210 Colorectal cancer     100344241    05225 Hepatocellular carcinoma     100344241    05226 Gastric cancer     100344241    05214 Glioma     100344241    05216 Thyroid cancer     100344241    05221 Acute myeloid leukemia     100344241    05220 Chronic myeloid leukemia     100344241    05218 Melanoma     100344241    05211 Renal cell carcinoma     100344241    05219 Bladder cancer     100344241    05215 Prostate cancer     100344241    05213 Endometrial cancer     100344241    05224 Breast cancer     100344241    05223 Non-small cell lung cancer     100344241   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100344241    05170 Human immunodeficiency virus 1 infection     100344241    05161 Hepatitis B     100344241    05160 Hepatitis C     100344241    05163 Human cytomegalovirus infection     100344241    05167 Kaposi sarcoma-associated herpesvirus infection     100344241    05165 Human papillomavirus infection     100344241   09164 Neurodegenerative disease    05010 Alzheimer disease     100344241    05022 Pathways of neurodegeneration - multiple diseases     100344241   09165 Substance dependence    05034 Alcoholism     100344241   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100344241   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100344241   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100344241    01522 Endocrine resistance     100344241  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100344241   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100344241    04031 GTP-binding proteins [BR:ocu04031]     100344241 Membrane trafficking [BR:ocu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100344241  Endocytosis   Macropinocytosis    Ras GTPases     100344241 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100344241   Exosomal proteins of other body fluids (saliva and urine)    100344241   Exosomal proteins of breast cancer cells    100344241   Exosomal proteins of colorectal cancer cells    100344241 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100344241 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  100344241 NCBI-ProteinID:  XP_008262848 Ensembl:  ENSOCUG00000022455 UniProt:  G1TRA4 LinkDB All DBs Position 13:49729353..49742146 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtggatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacattctggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt aagcgagtgaaagactcagatgatgtacctatggtgctggtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacttcagccaagaccagacagggtgtcgaagatgccttttacacactggta agggaaatacgccagtaccgaatgaaaaagctcaacagcagtgacgatgggactcaaggt tgtatggggctgccctgtgtggtgatgtaa

Oryctolagus cuniculus (rabbit): 100347487 Help Entry 100347487         CDS       T03373                                  Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04062   Chemokine signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04150   mTOR signaling pathway ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04211   Longevity regulating pathway ocu04213   Longevity regulating pathway - multiple species ocu04218   Cellular senescence ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04371   Apelin signaling pathway ocu04540   Gap junction ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04625   C-type lectin receptor signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04714   Thermogenesis ocu04720   Long-term potentiation ocu04722   Neurotrophin signaling pathway ocu04725   Cholinergic synapse ocu04726   Serotonergic synapse ocu04730   Long-term depression ocu04810   Regulation of actin cytoskeleton ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04915   Estrogen signaling pathway ocu04916   Melanogenesis ocu04917   Prolactin signaling pathway ocu04919   Thyroid hormone signaling pathway ocu04921   Oxytocin signaling pathway ocu04926   Relaxin signaling pathway ocu04929   GnRH secretion ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04960   Aldosterone-regulated sodium reabsorption ocu05010   Alzheimer disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05034   Alcoholism ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05165   Human papillomavirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05211   Renal cell carcinoma ocu05212   Pancreatic cancer ocu05213   Endometrial cancer ocu05214   Glioma ocu05215   Prostate cancer ocu05216   Thyroid cancer ocu05218   Melanoma ocu05219   Bladder cancer ocu05220   Chronic myeloid leukemia ocu05221   Acute myeloid leukemia ocu05223   Non-small cell lung cancer ocu05224   Breast cancer ocu05225   Hepatocellular carcinoma ocu05226   Gastric cancer ocu05230   Central carbon metabolism in cancer ocu05231   Choline metabolism in cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100347487    04012 ErbB signaling pathway     100347487    04014 Ras signaling pathway     100347487    04015 Rap1 signaling pathway     100347487    04370 VEGF signaling pathway     100347487    04371 Apelin signaling pathway     100347487    04068 FoxO signaling pathway     100347487    04072 Phospholipase D signaling pathway     100347487    04071 Sphingolipid signaling pathway     100347487    04151 PI3K-Akt signaling pathway     100347487    04150 mTOR signaling pathway     100347487  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100347487    04137 Mitophagy - animal     100347487   09143 Cell growth and death    04210 Apoptosis     100347487    04218 Cellular senescence     100347487   09144 Cellular community - eukaryotes    04540 Gap junction     100347487    04550 Signaling pathways regulating pluripotency of stem cells     100347487   09142 Cell motility    04810 Regulation of actin cytoskeleton     100347487  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100347487    04650 Natural killer cell mediated cytotoxicity     100347487    04660 T cell receptor signaling pathway     100347487    04662 B cell receptor signaling pathway     100347487    04664 Fc epsilon RI signaling pathway     100347487    04062 Chemokine signaling pathway     100347487   09152 Endocrine system    04910 Insulin signaling pathway     100347487    04929 GnRH secretion     100347487    04912 GnRH signaling pathway     100347487    04915 Estrogen signaling pathway     100347487    04914 Progesterone-mediated oocyte maturation     100347487    04917 Prolactin signaling pathway     100347487    04921 Oxytocin signaling pathway     100347487    04926 Relaxin signaling pathway     100347487    04935 Growth hormone synthesis, secretion and action     100347487    04919 Thyroid hormone signaling pathway     100347487    04916 Melanogenesis     100347487   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     100347487   09156 Nervous system    04725 Cholinergic synapse     100347487    04726 Serotonergic synapse     100347487    04720 Long-term potentiation     100347487    04730 Long-term depression     100347487    04722 Neurotrophin signaling pathway     100347487   09158 Development and regeneration    04360 Axon guidance     100347487   09149 Aging    04211 Longevity regulating pathway     100347487    04213 Longevity regulating pathway - multiple species     100347487   09159 Environmental adaptation    04714 Thermogenesis     100347487  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100347487    05206 MicroRNAs in cancer     100347487    05205 Proteoglycans in cancer     100347487    05207 Chemical carcinogenesis - receptor activation     100347487    05208 Chemical carcinogenesis - reactive oxygen species     100347487    05203 Viral carcinogenesis     100347487    05230 Central carbon metabolism in cancer     100347487    05231 Choline metabolism in cancer     100347487    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100347487   09162 Cancer: specific types    05210 Colorectal cancer     100347487    05212 Pancreatic cancer     100347487    05225 Hepatocellular carcinoma     100347487    05226 Gastric cancer     100347487    05214 Glioma     100347487    05216 Thyroid cancer     100347487    05221 Acute myeloid leukemia     100347487    05220 Chronic myeloid leukemia     100347487    05218 Melanoma     100347487    05211 Renal cell carcinoma     100347487    05219 Bladder cancer     100347487    05215 Prostate cancer     100347487    05213 Endometrial cancer     100347487    05224 Breast cancer     100347487    05223 Non-small cell lung cancer     100347487   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100347487    05170 Human immunodeficiency virus 1 infection     100347487    05161 Hepatitis B     100347487    05160 Hepatitis C     100347487    05163 Human cytomegalovirus infection     100347487    05167 Kaposi sarcoma-associated herpesvirus infection     100347487    05165 Human papillomavirus infection     100347487   09164 Neurodegenerative disease    05010 Alzheimer disease     100347487    05022 Pathways of neurodegeneration - multiple diseases     100347487   09165 Substance dependence    05034 Alcoholism     100347487   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100347487   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100347487   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100347487    01522 Endocrine resistance     100347487  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100347487   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ocu04031]     100347487 Membrane trafficking [BR:ocu04131]  Endocytosis   Macropinocytosis    Ras GTPases     100347487 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100347487 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase MeaB FeoB_N ATP_bind_1 Septin NPR1_interact G1_gp67_C Motif Other DBs NCBI-GeneID:  100347487 NCBI-ProteinID:  XP_051706297 Ensembl:  ENSOCUG00000012106 LinkDB All DBs Position 8:complement(96713956..96762247) Genome browser AA seq 216 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK SKTKCIIMLFTFLIRRKTVYLLSTEGQIHSEDQKEP NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg atacagctaattcagaatcactttgtggatgaatatgaccctacaattgaggattcctac aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt gtgtttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg ccttctagaacagtagacacaaaacaagctcaggacttagcaagaagttatggaattcct tttattgaaacatctgcaaagacaagacagggtgttgacgatgccttctatacattagtt cgagaaattcgaaaacataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag tcaaagacaaagtgtataattatgctgtttactttccttatcagaagaaagactgtttac ctgctgtcaacggaaggccagatccattcagaggatcaaaaggagccctga

DBGET integrated database retrieval system