KEGG   Oryctolagus cuniculus (rabbit): 100344467
Entry
100344467         CDS       T03373                                 
Symbol
STAT2
Name
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04621  NOD-like receptor signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344467 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100344467 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100344467 (STAT2)
   04625 C-type lectin receptor signaling pathway
    100344467 (STAT2)
   04062 Chemokine signaling pathway
    100344467 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100344467 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344467 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100344467 (STAT2)
   05160 Hepatitis C
    100344467 (STAT2)
   05171 Coronavirus disease - COVID-19
    100344467 (STAT2)
   05164 Influenza A
    100344467 (STAT2)
   05162 Measles
    100344467 (STAT2)
   05168 Herpes simplex virus 1 infection
    100344467 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100344467 (STAT2)
   05169 Epstein-Barr virus infection
    100344467 (STAT2)
   05165 Human papillomavirus infection
    100344467 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100344467 (STAT2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100344467 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 TPR_MLP1_2
Other DBs
NCBI-GeneID: 100344467
NCBI-ProteinID: XP_017197430
LinkDB
Position
4:complement(39918645..39937020)
AA seq 776 aa
MAQWEMLQDLDGPYQDLLHQLYSHSLLPVDIRQHLAAWIEDQNWREAVLGNDDSKATMLF
FHFLEQVNFECGRCSQDPECLLLQHNLRKFYRDLQAFPRGPTQLAEMMFNLLLEEEKILN
QAQRAQMEPGQPALGAPVESQQHDIESRLLDLKAMMEKLVKSISQLADLQDVFRFRYNTQ
AQGKAACSDPHWNRQQQLLQETLNELDKRRKEVLDDSKALLGRLTTLVDLLLPELDEWKA
QQQKACIGALQQPGLQQLEKWFTEGAKLLFHLWKLTKELQVTHLVTYENDPLIKGVDLQK
SQILELLKRLLYRAFVVETQPCMPQVLHRPLIIKTGSKFTARTRLLVRLQEGSESLTVEV
SIDRNPPQLQGFRKFNILTSNQKTLTPERGQSQGLVWDFGHLSLVEQRSGGSGKGSNKGT
LAVTEELHVISFTVKYTYQDLKLELRTDTLPVVVISNMNQLSIAXASILWFNLLSPNPQN
QQFFCSPPKAPWSLLGPALSWQFSSYVHRGLNPEQLAMLKDKLFGKSARNEDPLLSWADF
TKRESPPGKIPFWTWLDKILELVHDHLKELWKDGRIMGFVNRSQERRLLKKMVSGTFLLR
FSESSEGGITCSWVEHQEDDKVLICSVQPYTKEVLQSLPLTEIIRHYQLLTDENIPENPL
RFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQLDERQPPPLPLPLELEPKL
EPLELEPLELEPGLAPGPELALSLELGTLLETGLDLGLEPTLGLVPQSMPEPDMLP
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggcacagtgggagatgctgcaggatctggacggcccatatcaggatctgctacaccag
ctgtactcacatagcctcctgccagtggacattcgacagcacttggctgcctggattgaa
gaccagaactggcgagaagctgtgctgggcaacgatgattctaaggctaccatgctgttc
ttccacttcttggagcaagtgaacttcgagtgtggccgctgcagtcaagaccctgagtgc
ttgttgctgcaacacaacttgagaaaattctaccgggaccttcaggccttccccagaggc
cctacccaattggctgaaatgatgtttaacctccttttggaagaagaaaaaattctgaat
caggctcagagggcccagatggagccaggccagccggctctgggagcacctgtggagagc
cagcagcatgatatcgagtcccggctcctggatttgaaggctatgatggagaagctggtg
aagtccatcagccagctggcagacctgcaggacgtcttccgcttccgctacaacacacag
gcccaagggaaggcagcctgttcggaccctcattggaacagacagcagcagctactgcaa
gaaaccctcaatgaactggacaaaaggagaaaggaggtgctggatgactccaaagcactg
ttaggccgactgactaccctcgtcgacctgctgctgccggagctggatgagtggaaagcc
cagcagcaaaaagcctgcattggagccctccagcagcctgggctgcaacagctggagaag
tggttcacagagggagccaagctgctgtttcacctgtggaagctaactaaggagctgcag
gtgacccacctggttacctacgagaatgaccctctgatcaaaggtgtagacctgcagaag
tcccagatcctagaactgctgaagcgtctgctctacagagcctttgtggtcgaaacccag
ccctgcatgccccaggttctccatcgacccctcatcatcaagacagggagcaagttcact
gcccgaacaaggctgctggtcagactccaggaaggcagtgagtccctgaccgtggaagtc
tccattgacaggaatcctcctcaattacaaggcttccggaagttcaacattctgacctca
aaccagaaaacgttgacacccgaaagggggcagagtcagggcttagtttgggactttggc
cacttgtccctggtggagcagcgttcaggcggctcagggaagggcagcaataaggggaca
ctggctgtcacagaggagctgcacgtcatcagcttcacggtcaaatacacctaccaggat
ctgaagctggagctgagaacagacaccctccctgtggtagtcatctccaacatgaaccag
ctctccattgcctgagcctccattctctggttcaatcttctcagccccaacccccagaac
cagcagttcttctgcagccccccgaaggccccctggagcttgctgggccccgctctcagt
tggcagttctcgtcctatgttcaccggggcctcaacccggagcagctcgccatgctcaag
gacaagctgtttgggaagagcgctaggaatgaggacccattgttgtcctgggccgacttc
accaagcgagaaagcccccctggcaagatccccttctggacgtggctggacaaaattcta
gagctggtgcatgaccacctcaaggagctctggaaagacgggcgcatcatgggctttgtg
aatcgcagccaagagcgccggctgctgaagaagatggtgtctggcactttccttctgcgc
ttcagtgaatcgtcagaagggggcattacctgctcctgggtggagcaccaggaggacgat
aaggtgctcatctgctcagtgcagccctacaccaaggaggtgctgcagtcgctcccgctg
actgaaatcatccgccactaccagctgctcaccgacgagaacatccccgagaacccactg
cgcttcctctacccccgaatcccccgcgatgaggcttttggatgctactaccaggaaaaa
gttaatctccaggaacggaggaaatacctgaaacataggctcattgtggtctccaacaga
cagttggatgagcggcagccaccgccactaccactgccactggagctggagccaaaattg
gagccgttagagctggagccgttagagctggagccggggctagcaccaggcccggagcta
gcgttaagcctggagttagggaccctgctggagacagggctggacctggggctggagccc
acgctgggcctggtgccacagagcatgccagagccagacatgcttccgtga

DBGET integrated database retrieval system