Oryctolagus cuniculus (rabbit): 100344533 Help Entry 100344533         CDS       T03373                                  Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04010   MAPK signaling pathway ocu04020   Calcium signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04114   Oocyte meiosis ocu04218   Cellular senescence ocu04310   Wnt signaling pathway ocu04360   Axon guidance ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04625   C-type lectin receptor signaling pathway ocu04650   Natural killer cell mediated cytotoxicity ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04720   Long-term potentiation ocu04724   Glutamatergic synapse ocu04921   Oxytocin signaling pathway ocu04922   Glucagon signaling pathway ocu04924   Renin secretion ocu05010   Alzheimer disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05031   Amphetamine addiction ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100344533    04310 Wnt signaling pathway     100344533    04370 VEGF signaling pathway     100344533    04020 Calcium signaling pathway     100344533    04022 cGMP-PKG signaling pathway     100344533  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100344533    04218 Cellular senescence     100344533  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100344533    04650 Natural killer cell mediated cytotoxicity     100344533    04660 T cell receptor signaling pathway     100344533    04658 Th1 and Th2 cell differentiation     100344533    04659 Th17 cell differentiation     100344533    04662 B cell receptor signaling pathway     100344533   09152 Endocrine system    04922 Glucagon signaling pathway     100344533    04921 Oxytocin signaling pathway     100344533    04924 Renin secretion     100344533   09156 Nervous system    04724 Glutamatergic synapse     100344533    04720 Long-term potentiation     100344533   09158 Development and regeneration    04360 Axon guidance     100344533    04380 Osteoclast differentiation     100344533  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100344533   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100344533    05170 Human immunodeficiency virus 1 infection     100344533    05163 Human cytomegalovirus infection     100344533    05167 Kaposi sarcoma-associated herpesvirus infection     100344533   09171 Infectious disease: bacterial    05152 Tuberculosis     100344533   09164 Neurodegenerative disease    05010 Alzheimer disease     100344533    05014 Amyotrophic lateral sclerosis     100344533    05020 Prion disease     100344533    05022 Pathways of neurodegeneration - multiple diseases     100344533   09165 Substance dependence    05031 Amphetamine addiction     100344533   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100344533  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ocu01009]     100344533 Protein phosphatases and associated proteins [BR:ocu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100344533 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_FSTL1 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  100344533 NCBI-ProteinID:  XP_002708194 LinkDB All DBs Position 1:25514675..25515646 Genome browser AA seq 170 aa AA seqDB search MGNEASYPAEMCSHFDHDEIRRLGKRFRKLDLDKSGTLSVEEFMSLPELQQNPLVKRVID IFDMDGNGEVDFKEFILGTSQFSVKGNEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GNNLRDWQLQELVDKTIIILDKDGDGKISFEEFSTVVRGLEFHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaacgaggccagctacccggcagagatgtgctcccactttgaccatgatgaaatt agaagactgggcaaaaggtttaggaagctggacctggacaagtcgggcactctgagcgtg gaggagttcatgtccctgccagagcttcagcagaacccgttggtgaagcgagtgatcgac atcttcgacatggacggcaatggagaagtggacttcaaggaattcatcttggggacctct cagttcagcgtcaaaggaaacgaggagcagaagctgaggtttgctttcagcatctacgac atggacaaggacggctatatttccaacggtgagctcttccaggtgctgaagatgatggtg ggtaacaacctcagggactggcagttgcaggagctggttgacaaaaccatcatcatcctg gacaaggatggcgatgggaaaatatcctttgaggaattcagcactgtggttagaggcctg gagttccacaagaagttggtcgtcattgtatga

DBGET integrated database retrieval system