KEGG   Oryctolagus cuniculus (rabbit): 100344750
Entry
100344750         CDS       T03373                                 
Symbol
HERC3
Name
(RefSeq) probable E3 ubiquitin-protein ligase HERC3
  KO
K10614  E3 ubiquitin-protein ligase HERC3 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100344750 (HERC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100344750 (HERC3)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100344750 (HERC3)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100344750 (HERC3)
SSDB
Motif
Pfam: RCC1 HECT RCC1_2
Other DBs
NCBI-GeneID: 100344750
NCBI-ProteinID: XP_008265833
Ensembl: ENSOCUG00000008013
UniProt: A0A5F9DPY2
LinkDB
Position
15:complement(61345039..61488460)
AA seq 1050 aa
MLCWGYWSLGQPGISSNLQGIVAEPQVCGFIADRSVKEVACGGNHSVFLLEDGEVYTCGL
NTKGQLGHEREGNKPEQIGALADQHIVHVACGESHSLALSDRGQLFSWGAGSDGQLGLMT
TEDSVAVPRLIQKLNQQTILQVSCGNWHCLALAADGQFFTWGKNSHGQLGLGKEFPSQTS
PQRVRSLEGIPLAQVAAGGAHSFALSLSGAVFGWGMNNAGQLGLSDEKDRESPCHVKLLR
TQKVVYISCGEEHTAVLTKSGGVFTFGAGSCGQLGHDSMNDEVNPRRVLELMGSEVTQIA
CGRQHTLAFVPSSGLIYAFGCGARGQLGTGHTCNVKCPSPVKGYWAAHSGQLSARADRCK
YHIVKQIFSGGDQTFVLCSKYENSSPAVDFRTVNQAHYTSLINDETLAVWRQKLSEHNNA
NTINGVVQILSSAACWNGSFLEKKIDEHFKTSPKVPGIDLNSTRVLFEKLMNSQHSMILE
QILNSFESCLIPQLSSSPPDVEAMRIYLILPEFPLLQDSKYYISLTIPLAMAILRLDTNP
SKVLDNWWSQVCPKYFMKLVNLYKGAVLYLLRGRKTFLIPVLFNNYITAALKLLEKLYKV
NLKVKHVEYDTFYIPEISSLVDIQEDYLMWFLHQAGMKARPSIIQDTVTLCSYPFIFDAQ
AKTKMLQTDAELQMQVAVNGANLQNVFMLLTLEPLLARSPFLVLHVRRNNLVGDALRELS
IHSDIDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELLNPIYGMFTYYQDSNLLWFSDT
CFVEHNWFHLIGITCGLAIYNSTVVDLHFPLALYKKLLNVQPGLEDLKELSPTEGRSLQE
LLDYPGEDVEETFCLNFTICRESYGVTEQKKLIPGGDKVTVCKENRQEFVDAYVNYVFQV
SIHEWYTAFSSGFLKVCGGKVLELFQPSELRAMMVGNSNYNWEELEETAIYKGDYSATHP
TVKLFWETFHEFPLEKKKKFLLFLTGSDRIPIYGMGSLQIIIQSTASGEDYLPVAHTCYN
LLDLPKYSSKEILSARLTQALDNYEGFSLA
NT seq 3153 nt   +upstreamnt  +downstreamnt
atgttatgctggggatattggtctctgggccagccaggtatcagcagcaacctgcaagga
attgtggccgagccacaggtgtgtggcttcatagcggacagaagcgtcaaggaagtggcc
tgtggaggaaaccactccgtgttcctgctggaggatggagaggtgtacacgtgcggcctg
aacaccaaggggcagctgggccacgagagggaaggcaacaagccagaacaaattggagct
ttagcagatcagcacattgtgcatgtggcatgtggtgagtcccacagcctggccctcagc
gaccgcggccagctgttttcttggggtgcagggagtgatggtcagctaggactcatgaca
actgaggactccgtggcagtgcccaggttgatacaaaagctgaaccaacagaccatatta
caagtttcctgtggcaactggcattgcttggctcttgcagctgatggccagttcttcacg
tggggaaagaacagccatgggcagctgggcttaggaaaggagttcccctcacagaccagc
ccacagagggtgaggtcactggaagggatcccgctggctcaggtggctgctggaggggct
cacagctttgccctgtctctctcaggagccgtctttggctggggaatgaataatgcaggg
cagctagggctcagtgatgaaaaagatcgagagtctccatgccacgtgaaactcttacga
acacaaaaagtggtctatattagttgtggagaagaacacacagcagtcctcacgaagagc
ggaggtgtgtttacctttggcgctggttcctgtgggcaacttggacatgactccatgaat
gacgaggttaatccgagacgagttctagagctgatgggcagtgaagtaactcagattgct
tgtggcaggcagcacaccctagcctttgtgccttcttctggactcatctatgcatttggt
tgtggagctagaggccaactgggaactggacacacttgcaacgttaaatgcccatctccc
gtgaagggttactgggctgcccacagtggccagctttcagcccgagctgatcgctgtaaa
tatcatattgttaagcagatcttctctggaggagaccagactttcgtgctttgctccaaa
tacgagaattcttctcctgctgttgacttcaggactgtgaaccaagcacattataccagt
ttaataaatgatgaaaccttagcagtgtggagacaaaaactgtcagaacacaacaacgcg
aatacaatcaatggtgttgttcagatattgtcttctgcagcctgttggaatggaagtttt
ctggaaaaaaaaattgatgaacatttcaaaacgagccccaaagtccctggaattgacctg
aactcaactagggtgttatttgagaagttaatgaactctcagcactccatgattctggaa
cagatcttaaatagctttgaaagttgcctgattcctcagttgtcaagttcaccaccggat
gttgaagcaatgagaatctatttaatactgcccgagtttcctctgctccaggactctaag
tattacatatcgttgactatccccttggctatggctattctgcggctggacacaaacccc
agcaaagtattagataactggtggtctcaggtgtgcccaaagtacttcatgaagctggtt
aatctctataaaggtgcagtcctttatctactgaggggaagaaagacgtttttaattcca
gtactatttaacaattatattacagcagctctcaagctcctggagaaattatataaggtg
aaccttaaagtgaaacacgtggaatatgataccttttacattcctgagatttccagtctg
gtggacattcaggaagactacctcatgtggttcttgcatcaagcagggatgaaggccaga
ccatctataatccaggacaccgtaacactttgttcctaccctttcatctttgatgcccaa
gctaagactaaaatgttacagactgatgctgaactacagatgcaggtggcggtcaatggg
gccaacctgcagaacgtcttcatgctgctcaccctggagcctctgctggccagaagcccc
ttcttggtccttcacgttcgcaggaacaacctcgttggagacgccctccgagagctgagc
attcattctgacatcgatttgaaaaaacctctcaaagtgatctttgatggtgaggaggca
gtggatgctggtggtgtcacaaaagagttctttcttttgctattgaaagaacttttgaat
cccatctatggaatgtttacatactatcaggattcaaatctcttgtggttttccgacacg
tgttttgtagagcacaactggtttcacctgattggcataacctgtggactcgctatctac
aactccaccgtggttgacctccacttcccgctggccctctacaagaagttactaaatgta
cagcctggcttggaagacctgaaggagctgtcgcccactgaaggaaggagtcttcaggag
cttttagattaccctggggaagatgtcgaggaaactttctgcctcaacttcacgatctgc
cgagaaagctacggagtgactgaacagaagaagttgatacctgggggagacaaggtgact
gtgtgcaaggagaacaggcaggaatttgtggatgcatatgtgaattatgtcttccaagtc
tcaattcacgagtggtacacggccttctccagcggtttcctaaaggtgtgtggtggcaaa
gtccttgagctcttccagccttccgaactgagggctatgatggtggggaacagcaactac
aactgggaagaactggaagagactgccatctacaagggtgattactcagccacacatccc
actgtgaaactattttgggaaacgtttcatgagtttccattggaaaagaagaagaagttc
ctcttgttcctgactggcagcgaccggattcccatctacggcatgggcagcctgcagatc
atcatccagtccaccgccagcggggaagactacttgcctgtggcccacacttgctacaac
cttctcgacctccccaagtacagcagcaaagagattctgagtgcgcggctgacacaggcg
ctcgacaactacgaggggtttagtttggcctga

DBGET integrated database retrieval system