KEGG   Oryctolagus cuniculus (rabbit): 100344755
Entry
100344755         CDS       T03373                                 
Symbol
HERC1
Name
(RefSeq) HECT and RLD domain containing E3 ubiquitin protein ligase family member 1
  KO
K10594  E3 ubiquitin-protein ligase HERC1 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100344755 (HERC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100344755 (HERC1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100344755 (HERC1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100344755 (HERC1)
SSDB
Motif
Pfam: RCC1 RCC1_2 HECT SPRY WD40 CLASP_N
Other DBs
NCBI-GeneID: 100344755
NCBI-ProteinID: XP_002718216
Ensembl: ENSOCUG00000014796
UniProt: G1T873
LinkDB
Position
17:8406904..8631441
AA seq 4860 aa
MATMVPPVKLKWLEHLNSSWITEDSESIATREGVAVLYSKLVSNKEVVPLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSADVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVNTMEKSKLLSSQEGMISFDCFM
TILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHNFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDAADLSSVCTGYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAFCHINNISENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAAALLEDQELQWPLHGGPELIDPAGVPLPQPAQSWVWLVD
LERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQLDKCMSCLLEVA
LSGNEEQKPFDYKLRPEIAVYVDLALGCSKEPARSLWINMQDYAVSKDWDSATLSTESLL
DTVSRFVLAALLKHTNLLSQACGESRYQPGKSLSEVYRCVYKVRSRLLACKNLELIQTRS
SSRDRWISDNQDSADADPQEHSFTRTIDEEAEMEEQAERDREEGHPEPEDEEEEREHEVM
TAGKIFQCFLSAREVARSRDRDRMNSGAGSGARADDPPPQSQQERRVSTDLPEGQDVYTA
ACNSVIHRCALLILGVSPVIDELQKRREEGQLQQPSTSASEGGGLMTRSESLTAESRLVH
ASPSYRLIKSRSESDLSQPESDEEGYTLSGRRNVDLDLASSHRKRGPVHSQLESLSDSWT
RLKYSRDWLCNSSYSFESDFDLTKSLGVHTLIENVVSFVSGDVGNAPGFKEPEESMSTSP
QASIIAMEQQQLRAELRLEALHQILVLLSGMEEKGSISLAGSRSGSGFQSSTLLTSVRLQ
FLAGCFGLGTVGHSGTKGESGRLHHYQDGIRAAKRNIQIEIQVAVHKIYQQLSATLERAL
QANKHHIEAQQRLLLVTVFALSVHYQPVDVSLAISTGLLNVLSQLCGTDTMLGQPLQLLP
KTGVSQLSTALKVASTRLLQILAITTGTYADKLSPKVVQSLLDLLCSQLKNLLSQTGVLL
IASFGEGEEDGEEEMKKADSSGETEKKDFRAALRKQHAAELHLGDFLVFLRRVVSSKAIQ
SKMASPKWTEVLLNIASQKCSSGIPLVGNLRTRLLALHVLEAVLPACESGVEDDQMAQVV
ERLFSLLSDCMWETPIAQAKHAIQIKEKEQEIKLQKQGELEEEDENLPIQEVSFDPEKAQ
CCLVESGQILTHGSGGKGYGLASTGVTSGCYQWKFYIVKENRGNEGTCVGVSRWPVHDFN
HRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTISFGKNGEEPKLAF
EDVDAAELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPICSPVATVLAEATIQLIR
ILHRTDRWTYCINKKMMERLHKIKICIKESGQKLKKSRSVQSREENEMREERESKEEEKG
KHNRHGLADLSEPQLRTLCLEVWPVLAVIGGVDAGLRVGGRCVHKQTGRHATLLGVVKEG
STSAKVQWDEAEITISFPTFWSPSDTPLYNLEPCEPLPFDVARFRGLTASVLLDLTYLTG
IHEDMGKQSTKRHEKKHRHESEEKGDTEQKPESESALDARTGLTSDDVKSQGTTSSKSES
EIASFSLDPTLPGVESQHQITEGKRKNHEHISKNHDIAQSEIRAVQLSYLYLGAMKSLSA
LLGCSKYAELLLIPKVLAENGHNSDCASSPVVHEDVEMRAALQFLMRHMVKRAVMRSPIK
RALGLADLERAQAMIYKLVVHGLLEDQFGGKIKQEIDQQAEESDHAQQAQTPVTTSPSAS
STTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTVLPTRRAQT
PPISSLPTSPSDEVGRRQSLTSPDSQSARPANRTALSDPSSRLSTSPPPPAIAVPLLEMG
FSLRQIAKAMEATGARGEADAQNITVLAMWMIEHPGHEDEEEPQPGSTADSRHGAAVLGS
GGKSNDPCYLQSPGDIPSADATEMEEGFSESADNLDHTENAASGSGPPARGRSAVTRRHK
FDLAARTLLARAAGLYRSVQAHRNQSRREGISLQQDPGALYDFNLDEELEIDLDDEAMEA
MFGQDLTSDNDILGMWIPEVLDWPTWHVCESEDREEVVVCELCECSVVSFNQHMKRNHPG
CGRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGSCREKYLALKTKSKTASSERYKGQ
APDLIGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLNDRRIVPEPVQFPDSDPL
GASVAMVTATNSMEETLMQIGCHGSVEKSSSGRITLGEQAAALANPHDRVVALRRVTAAA
QVLLARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCLAAAGRAGLSTSPSA
MASTSERSRGGHNKANKPISCLAYLSTAVGCLASNTPSAAKLLVQLCTQNLISAATGVNL
TTVDDPIQRKFLPSFLRGIAEENKLVTSPNFVVTQALVALLADKGAKLRPNYDKTEVEKK
GPLELANALAACCLSSRLSSQHRQWAAQQLVRTLAAHDRDNQTTPQTLADMGGDLRKCSF
IKLEAHQNRVMTCVWCNKKGLLATSGNDGTIRVWNVTKKQYSLQQTCVFNRLEGDAEESL
GSPSDPSFSPVSWSISGKYLAGALEKMVNIWQVNGGKGLVDIQPHWVSALAWPEEGPAAA
WSGESPELLLVGRMDGSLGLIEVVDVSTMHRRELEHCYRKDVSVTCIAWFSEDRPFAVGY
FDGKLLLGTKEPLEKGGIVLIDAHKDTLVSMKWDPTGHILLTCAKEENVKLWGPAAGCWR
CLHSLCHPSIVNGIAWCSLPGRGSKLQLLMATGCQSGLVCVWRIPQDTTQTSMTSSEGWW
DQESNCQDGCRKSAGVKCVYQLRGHITPVRTVAFSSDGLALVSGGLGGLMNIWSLRDGSV
LQTVVIGSGAIQTTVWIPEVGVAACSNRSKDVLVVNCTAEWAAANHVLATCRTALKQQGV
LGLNMAPCMRAFLERLPMMLQEQYAYEKPHVVCGDQLVHSPYMQCLASLAVGLHLDQLLC
NPPVPPHHQSCLPDPASWNPNEWAWLECFSTTIKAAEALTNGAQFPDSFTVPDLEPVPED
ELVFLMDNSKWINGMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPA
AAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVV
TQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSC
GFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAV
SADGSMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVACGTQFSVALTKDGHVY
TFGQDRLIGLPEGRARNHNRPQQVPVLAGVVIEDVAVGAEHTLALASTGDVYAWGSNSEG
QLGLGHTNHVREPTLVTVLQGKNIRQISAGRCHSAAWTAPPVPPRAPGVSVPLQLGLPDA
VPPQYGALREVSIHTVRARLRLLYHFSDLMYSSWRLLNLSPNNQNSTSHYNAGTWGIVQG
QLRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKCKPIFVQIARQVVKLN
ASDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGIVDLLIPSPNATAEVGYNR
DRFLFNPSACLDEHLMQFKFLGILMGVAIRTKKPLDLHLAPVVWKQLCCIPLTLEDLEEV
DLLYVQTLNSILHIEDSGITEESFHEMIPLDSFVGQSADGKMVPIIPGGNSIPLTFSNRK
EYVERAIEYRLHEMDRQVAAVREGMSWIVPVPLLSLLTAKQLEQMVCGMPDISVDVLKKV
VRYREVDEQHQLVQWFWHTLEEFSNEERVLFMRFVSGRSRLPANTADISQRFQIMKVDRP
YDSLPTSQTCFFQLRLPPYSSQLVMAERLRYAINNCRSIDMDNYMLSRNVDNAEGSDTDY
NT seq 14583 nt   +upstreamnt  +downstreamnt
atggcaactatggttccaccagtgaaactgaaatggcttgaacacttgaacagctcctgg
attacagaagacagtgaatccattgctacaagagagggagttgctgtcttgtactctaaa
ctggtcagcaataaggaagtagtacctttacctcaacaagttttatgtctcaaaggacca
cagttgcctgactttgaacgtgaatctctttcaagtgatgagcaggaccactatttggat
gctcttcttagtagtcagttagcactagcaaagatggtgtgttcagattctccatttgct
ggggcacttcgaaaacgactgcttgtacttcagcgtgtcttctatgcactttctaacaaa
taccatgacaaaggcaaagtgaaacagcagcagcactctcccgaaagcagctctggttca
gcagatgtccattctgttagtgaacgaccccggtcaagcactgatgcacttatagaaatg
ggtgttcgaactggtctaagtttattatttgcacttctcagacaaagttggatgatgcct
gtgtcgggacctggcctcagtctttgcaacgacgttatccatactgcaattgaagttgtg
agctctttgcctccattgtctttagcaaatgagagcaaaattcctcctatgggcttggac
tgcttatcacaagtaacaacgtttcttaaaggagtaactattcccaattctggggcagac
actttgggtcgcagattagcttccgagttgctgcttggtttagcagctcagcgaggctcc
ttgaggtatcttcttgaatggatagaaatggctttgggggcttctgcagttgtaaatacc
atggagaagagtaaactactatcaagccaggaaggaatgatcagctttgattgctttatg
actatattaatgcagatgagacgttctttgggttcatctgctgatcgaagtcagtggaga
gaaccaaccagaacgtctgatggcttgtgctcactctatgaggcagcattatgtctcttt
gaagaggtttgtagaatggcttctgattactcaagaacatgtgctagcccagatagcatt
cagactggtgatgctcccattgtctcagaaacctgtgaggtttacgtttgggggagtaac
agcagccatcagctggtagaaggcacacaggagaaaatattacaacccaagttggctcct
agtttctctgatgctcagaccattgaagctggacagtactgcacttttgtcatttctacg
gatggttctgtcagagcttgtggtaaaggcagctatgggagactgggccttggagattcc
aataatcaatctactttaaaaaagttgacgtttgagccacacaggtccattaaaaaggtt
tcctcttctaaaggatctgacggtcacactttagcttttacaacagaaggagaagtcttc
agttggggagatggtgattatgggaagctgggacatggaaatagttcgacccagaaatat
cccaagcttattcagggccctcttcagggaaaggtagttgtttgtgtgtcagctggatac
agacatagtgctgctgtcacagaagatggtgaattatatacatggggtgaaggagacttt
ggacgattaggtcatggtgatagtaatagtcgtaacattccaacattagtaaaagacatc
agcaatgtaggagaggtttcttgtggcagttcacatactattgctttatccaaagatggg
agaactgtatggtcttttggaggaggagacaatggcaaacttggccatggtgataccaac
agagtatataaacctaaagttattgaagctttacaaggaatgttcattcgcaaagtttgt
gctgggagccagtcttcacttgctttgacgtcaacaggacaggtctatgcttggggctgt
ggcgcttgtctaggttgtggttcttcagaagctactgctttgagacctaagctaatcgaa
gaattggctgccacaagaatagttgatatttcaattggagacagtcattgtttggctctt
tctcatgataatgaagtttatgcctggggcaataactcaatggggcagtgtggccaagga
aattccacaggtcctattactaaaccaaagaaagtgagtggcttggatggcatagctatt
cagcagatctcagcaggaacatcccatagtttagcatggactgctcttccgagggacaga
caagttgttgcatggcaccgaccttattgtgtagatcttgaagagagtaccttttcacat
ctgcgttcttttcttgagagatactgtgataaaataaacagtgagattcccccactccct
ttcccttcatcaagggaacaccacaatttcctcaagctctgcctgaagctgctttcaaat
cacctagctctcgcacttgcgggaggtgtagctaccagtattcttggaagacaggcaggt
ccacttcggaatttgctcttcaggctgatggactcaactgtccccgatgaaatccaagaa
gtggtaattgaaactctttcagtgggagctaccatgctattacctccattacgagaacgg
atggaattacttcattctcttttaccccaaggacctgatagatgggaaagcttgtctaaa
ggacagcgaatgcaactggatataattctaacaagtttgcaagatcatacccatgtagcc
tccctacttggctacagctcaccctctgatgctgctgacctctcttctgtgtgtactggt
tatggcaacctgtcagatcaaccttatggcactcagagctgccatccagacacccatctg
gctgaaattttgatgaagactctcttaagaaatttaggattttacacagatcaagcattt
ggagaactagaaaagaatagtgataaattcctacttggaacatcgtcctcagagaacagt
cagcctgctcatctgcatgaactgctgtgctctctgcagaaacaactgttggcgttttgc
catattaataacattagtgaaaactcgagcagtgtggcattgcttcataagcatctgcag
ctcttgttgcctcatgccacagatatttattcacgttctgcaaatttgctcaaagaaagt
ccttggaatggcagtgttggagaaaaattaagagatgtgatatacgtctcagctgcaggc
agtatgctctgccagattgttaactccctgctgttactccccgtgtcagtggctcggcct
ttattaagttacctcctcgacctgttgcctcctcttgattgccttaatagactcttgcca
gctgctgctcttttagaagaccaagagttacagtggcctcttcatggaggaccagaactg
atagatcctgctggtgtgccattacctcagcctgctcagtcctgggtgtggcttgtggat
ctggaaagaacgattgctctccttattgggcggtgtcttggtggcatgcttcagggctcc
ccagtgtctccagaggaacaggacactgcatattggatgaaaacaccacttttcagtgat
ggtgtagaaatggacacccctcagttagataaatgcatgagttgcctattagaagtagct
ctttcaggaaatgaagagcagaagccttttgattataagttacggcctgaaattgctgtc
tatgtagacttggcattgggttgctctaaagagccagcacgaagcctttggatcaacatg
caggattatgctgttagtaaagattgggacagtgcaactctaagtactgagtcactcttg
gacactgtgtctagatttgttcttgcagcccttctgaaacacacaaatttacttagtcaa
gcatgtggagaaagccgatatcaacctggtaaaagcttatcagaagtgtaccgttgtgtt
tacaaagttcgaagtcgtttacttgcttgcaagaaccttgaacttattcagaccaggtca
tcgtcacgagacagatggatttcagacaaccaggactctgcagacgctgatcctcaggag
cattcatttacccggaccattgatgaagaagccgaaatggaagaacaggctgagagagat
cgggaagagggtcatccagagccagaggatgaggaagaagaacgggaacatgaagtgatg
acagctggcaaaatctttcagtgtttcctctcagcccgtgaagtagctcgtagccgagac
cgagatagaatgaacagtggggcagggtctggggctcgagctgatgatccacctcctcag
tctcagcaagagcgaagggtcagcacagaccttcctgagggtcaggatgtgtataccgct
gcctgcaactctgtgatccatcggtgtgccctgttaatattaggagtaagtcctgtgatt
gatgaacttcagaagcgaagggaagaaggacagttacaacagccttcaacaagtgcctct
gaagggggtggacttatgaccaggagtgaaagtcttactgcagagagccgactagtccac
gcaagtcccagttatagactgatcaaatcaaggagtgaatctgacttgtctcagcctgaa
tcagatgaagaaggttataccttgagtggcagacggaatgttgatttggatttggcatca
tctcacagaaagagaggtcctgtgcacagtcagttggaatccctgagtgactcttggact
cgcctgaaatacagcagagactggctgtgtaactcttcttactcctttgagtctgatttt
gatcttacaaagtctttgggagttcacactttgattgaaaatgttgtaagctttgtgagt
ggagatgtggggaatgcccccggttttaaagagccagaggaaagtatgtctacaagtccc
caggcatccatcattgcaatggaacagcagcagttaagagcagaacttcgtttagaggca
cttcaccagatccttgttctgttgtctggaatggaggaaaaaggaagcatctcactggca
ggaagcaggtcaggatcaggcttccagtcatccacactgctcacatctgtgagactgcag
tttctagcagggtgttttggtttaggcactgttggacactcaggaaccaaaggagagagt
ggccgtttgcatcactatcaggatgggatcagagcagctaagcgaaatattcagattgaa
atccaggtggctgtgcataagatttatcaacagttatctgccacgctagagagagccttg
caagcaaacaaacatcacattgaagcccagcaacgtctccttttggttacagttttcgcc
ctgagtgttcattatcaaccagtggatgtttctttggcaatttccactggtctcctaaat
gttctgtcacagttatgtggcacagacaccatgttaggacagcccctgcaattgttgcca
aagacaggtgtttctcagcttagcacagctttgaaagtggccagtacaaggttgctccag
attttagccatcactacggggacttatgctgataaactgagtcccaaggtagttcaatcc
ctattggacctactctgtagtcagttgaagaatttgttgtcccaaactggtgtactactt
atagcctcctttggagaaggggaagaagatggggaagaagaaatgaaaaaagcagactcc
agtggagaaactgagaagaaagatttcagagctgctctcaggaaacaacatgcagccgaa
ctccatttaggggattttttagtttttcttcgcagagttgtgtcttcaaaagcaattcag
tcaaaaatggcttccccaaagtggacagaggtgcttctaaatatagcatctcagaagtgt
tcttcaggtattcctctagttggtaacttaagaacaaggctccttgcacttcatgtcctt
gaagctgtgctaccagcttgtgaatctggtgtagaagatgatcagatggcccaggttgtc
gaacgcttattttcccttctgtcggattgtatgtgggagactccgattgctcaggccaaa
catgctattcagataaaggaaaaagaacaagaaataaaactacagaagcaaggagagctg
gaagaagaagatgagaatcttcctatacaggaagtatcttttgatccagagaaagctcag
tgttgcctggtggaaagtgggcagattttaactcatggcagtggaggaaaaggttatgga
ttggcatcaactggagttacttcagggtgctatcaatggaagttttacattgtgaaagaa
aacagaggtaatgaaggcacgtgtgttggagtttctcgctggccagtacatgactttaac
caccgtactacctcagatatgtggctctatagggcctacagtggtaacctctatcacaac
ggagaacagactctgactttgtccagctttacccaaggagatttcatcacctgtgtgtta
gacatggaagccaggaccatttcctttgggaaaaatggagaggagcccaagttagctttt
gaagatgtagatgcagcagagttgtacccatgcgtaatgttctatagcagtaatccaggt
gaaaaggtgaaaatttgtgatatgcagatgcgtggtacaccacgagacttacttccaggc
gatcctatttgtagtccagtagcaacagtgctggctgaggccactattcagctcatccgc
atccttcaccgaacagaccgttggacttactgcattaacaaaaaaatgatggaaaggctg
cacaaaattaaaatatgtattaaagagtcaggtcagaagctgaagaaaagccgctcagtt
cagagccgagaagaaaatgaaatgagagaagaaagggagagcaaagaagaagagaaaggc
aaacataatagacacggccttgctgacctctcagagccacagctgaggaccctgtgctta
gaggtgtggcctgttctggccgtgatcggaggagttgatgctggtctccgagttggaggc
cgttgtgttcacaagcagactgggcgccatgccacgctgctgggagtggtcaaagagggc
agcacatctgccaaggtccaatgggatgaagcagaaattaccatcagcttcccaactttt
tggtcgcctagtgatactcccttgtataacctggagccctgtgaaccactgccgtttgac
gtggcacgattccgaggcctgacagcatctgtgctgctggacctaacatatctgactggc
attcatgaagacatggggaaacagagcaccaagcgtcatgaaaagaaacaccgtcacgag
tctgaggagaaaggggacactgagcagaaacccgagagtgaatctgccttagacgcgcgc
acaggcttaacatctgatgatgtcaaaagtcagggcaccacaagctccaaatcagagagt
gaaatagcttcgttttctttagatccgacgctgccaggtgtggaatcccaacatcaaata
acagaaggaaaaagaaaaaatcatgaacatatatccaaaaaccacgacatagcccagtca
gaaatcagagcagtccagctgtcctatctctacctcggtgctatgaaatcgctgagtgct
cttcttggctgtagtaaatatgctgagctattgctgataccaaaagttctggctgaaaat
ggccacaactcggactgtgcaagttctccagttgttcacgaagatgtggagatgcgtgca
gccctgcagttcttgatgcgacacatggtgaagcgagcagtcatgcggtcgcccataaag
agagcattgggattagctgatctggaacgtgctcaagccatgatctataaattagtcgtc
catgggcttttggaagaccagtttgggggcaaaattaagcaagagattgatcaacaagct
gaagaaagtgaccacgcccagcaggctcagacaccagtcaccaccagcccctcggcctcg
agcaccacgtccttcatgagcagctccctggaggacacgacaactgccaccaccccagtc
actgacacagagacggtgcctgcctctgagtccccaggagtgatgccacttagcctgctc
aggcaaatgttctctagttacccaactaccactgtacttcccacacgtcgtgcacagact
cctccaatatcatcgttaccaacctctccttctgatgaagtaggaaggaggcaaagttta
acttctcctgattcgcagtcagcaaggccagctaaccgcacagccttgtcagatccgagc
agtagactttcaacttctcctcctcctccagcaattgcagtccccttgctcgaaatgggg
ttttctctccggcagatcgccaaagctatggaagctacaggtgctcggggagaagctgat
gcccagaacatcactgtccttgccatgtggatgatagagcaccctgggcatgaggatgag
gaagagccccagccaggcagcacagcagactcgaggcatggagcagcagttctaggcagc
ggcgggaagtcaaatgatccgtgttatttgcaatcaccaggagacataccatcagctgat
gctacagaaatggaggagggctttagtgaaagcgctgataatctggatcacacagagaat
gcagcttctggaagtggtccaccagctcgaggtcgctcagcagtaacaagaaggcacaag
tttgatttagcagctcgcacattgctagcaagagcagcggggttataccgctctgtgcag
gcccacaggaatcaaagtcggagagaaggaatatctttgcagcaagacccaggggcgttg
tatgactttaatttagatgaggagttggaaattgatcttgatgatgaagcaatggaagct
atgtttggacaagacctgaccagtgacaatgatattctgggaatgtggatcccagaggta
ctggattggcctacctggcatgtttgtgagtctgaagacagggaagaagtggtggtgtgt
gaactgtgcgaatgcagtgtcgtcagcttcaatcagcacatgaagagaaaccacccaggc
tgtgggcgtagtgcaaaccgccagggctatcgcagcaatggctcctatgtggacggctgg
tttggtggtgaatgtgggagtggaaatccatactacctgttatgtggcagctgcagggag
aagtacttagccctgaagaccaaatctaagacagcaagttctgaaaggtacaagggacaa
gctccagatctaattggcaagcaagacagtgtgtatgaagaagactgggacatgttggac
gttgatgaggatgaaaagctaacgggtgaagaagaatttgaattgcttgcaggaccactt
gggttaaatgaccggcgcattgtaccagaaccagttcagttccctgacagcgacccactg
ggagcctcagtagcaatggtcacagccaccaacagtatggaagaaactctgatgcaaata
ggttgccatggctctgtagaaaagagttcctctgggagaataacgttgggagagcaggca
gctgccctggccaaccctcatgacagggtagtggctttgaggagagtgactgctgctgct
caggttcttctggccagaaccatggtcatgagagcactctctcttctctcagtcagtggt
tccagctgtagcttggctgctggtcttgagtcgctggggctaacagatattagaacactg
gttcgattaatgtgcttggccgcagcagggagagctggcctctccaccagcccttctgcc
atggcaagcacctcagaacgctcacgaggtgggcacaacaaggccaacaagcctatctct
tgcctggcctatctgagcaccgcggtgggatgtctggcatcaaatacacctagtgctgcg
aagctgctggtgcaattgtgtacacagaacttgatttctgctgcaacaggtgtaaatcta
accacagttgatgatccaattcagcgaaaatttctacccagctttcttcgaggaattgct
gaagagaataagcttgtaacctctccaaactttgttgtaactcaggcccttgtggcatta
ctagcagataaaggggccaaactgagacctaactatgataagacagaagttgaaaagaaa
ggccctctggagctggctaatgccctggcagcctgctgcctgtcctccaggctgtcctca
cagcataggcaatgggctgctcaacaacttgtgcgcactcttgctgcacacgaccgtgac
aaccaaactactccacaaacgctcgctgatatgggaggagatctcagaaaatgctccttt
atcaagctggaggctcatcagaacagagtaatgacatgtgtgtggtgcaataaaaaaggt
ctcttggctacaagtggcaatgatggcaccattcgggtgtggaatgttaccaaaaagcag
tattcactgcagcagacctgcgtgttcaatcgactggaaggggatgctgaggaaagcctg
ggatcccccagtgatccaagtttctcgcctgtttcctggagcatcagtgggaagtatctg
gctggggctttggaaaagatggtgaatatctggcaagttaatggaggaaaaggattagta
gacattcagcctcactgggtatctgcactggcttggcctgaagagggcccagctgcagcc
tggtcaggagagtctccggagttattgttggtgggccggatggatgggtctctaggactg
attgaagttgttgatgtgtccaccatgcaccgtcgagaattggagcattgctatcggaag
gatgtgtctgttacttgcattgcttggttcagtgaagacagaccatttgcagtgggatac
tttgatggaaaattgttgctgggaacaaaggaaccgcttgagaaaggtggcattgtccta
attgatgcacataaggatacccttgttagtatgaagtgggacccaacagggcatattctt
ttgacatgtgccaaagaagagaatgtgaaactctggggacctgctgcaggatgctggcgc
tgtctccattcactctgccatccgtctattgtaaatggcattgcttggtgcagtcttcca
gggagaggatccaagttgcagttactgatggctactggctgtcagagtggcttagtatgt
gtttggcgtattccacaagacaccacacagaccagtatgactagttcagaaggatggtgg
gaccaggaatcaaattgtcaggatggctgtaggaagtcagcgggcgtcaaatgtgtttat
cagctccggggacacatcactcctgttcgcaccgtggccttcagttctgacggcttggcc
ctggtgtcaggtggactcggtgggctcatgaacatttggtctttaagggatggttctgtc
ttgcaaactgttgtaataggctctggagctattcagaccacagtatggattccagaagtt
ggagtagctgcttgctcaaatagatcaaaggatgttttggtcgtgaattgtacagcagaa
tgggctgctgccaatcatgttttagcaacctgtaggacagcactgaaacaacagggcgtt
ctcggattaaacatggctccctgcatgagagcctttctggagcggctgcccatgatgctt
caggagcaatacgcctatgaaaagcctcatgtggtgtgtggcgaccagcttgttcacagc
ccctatatgcagtgtctggcgtccctggcggtgggacttcacctggatcagctgttgtgt
aaccctccagtgccaccgcatcaccagagctgcctccctgatcctgcctcatggaatcca
aatgagtgggcctggttagaatgtttctcaaccaccattaaagctgctgaagccctgact
aatggcgcacagtttccagactcttttactgttccagatctagaacctgttccagaggat
gaacttgtgttcctaatggataacagtaagtggattaatggcatggatgaacaaattatg
tcttgggcaacttctagacctgaggactggcacctgggaggtaaatgtgatgtctacctg
tggggtgctggcaggcatgggcagctggcagaggctggaagaaacgtgatggttcctgct
gcagctccatcattctctcaggcccaacaggtcatatgtggtcagaactgtacctttgtc
atccaggccaatggcacagtgttggcttgtggggaaggaagttacggcagattaggacaa
gggaattcagatgaccttcatgtgctgacagttatttcagccttacaaggctttgtggtg
acccagctggtgacttcttgtggttctgatgggcactcgatggccctgactgaaagcggt
gaagtctttagctggggagatggtgactatggtaaacttggccacgggaacagcgacagg
cagcggcggcccaggcagatcgaggccttacaaggagaagaagtggtgcagatgtcttgt
ggcttcaagcactcagcagtggtgacttcagatggcaaactgttcacctttgggaatggt
gactatggacgtctgggtcttggaaacacctctaacaaaaagctgccagagagagtgact
gcactggaggggtatcagattggacaggtggcctgtggactaaaccacactttggctgtg
tcagcagatggctccatggtgtgggcttttggagatggagactatggaaaattaggttta
gggaattccactgcaaaatcttcacctcagaaagtagatgtcctttgtggtattggaata
aaaaaggttgcttgtggaactcagttttctgttgctttgactaaagatggtcacgtgtat
acctttggtcaagatcgcttaataggcttgccagagggtcgtgctcgtaatcacaatcga
ccacagcaagttcctgtcctggctggagtggtcatcgaagacgtggcagtcggagctgag
cacacgcttgctttggcatcgactggcgatgtgtatgcctgggggagcaattctgaagga
cagctcggcctaggccacaccaaccacgttcgagaaccaaccctagtaacagttctgcaa
gggaaaaacattcggcagatctcagctggccgctgccacagtgctgcgtggacggcgcca
ccagtgccacccagagcaccaggtgtgtcggtacctctgcagctgggcctgcccgatgca
gtacccccacagtacggggcactgagggaggtgagcattcacaccgtacgtgccaggctg
cggctgctctaccacttctccgacctcatgtactcctcctggaggctcctgaacctcagc
cccaacaaccagaacagcacatctcattataacgctggaacctggggcattgtgcaagga
cagcttcggcctttattagccccaagagtctacactcttcccatggtgcgctccatagga
aaaaccatggttcaaggcaaaaactatggacctcaaattactgtaaagaggatatcaacc
agaggtcggaagtgtaagcccatctttgtccagatagcaagacaagtagttaaactgaat
gcatccgatctccgtctgccctcccgagcatggaaggtgaagctggttggagaaggggcc
gatgatgctggaggagtgtttgacgacaccatcaccgaaatgtgccaggaacttgaaact
ggtatagttgacctccttataccctctccaaatgccaccgcggaagtgggttacaacagg
gacaggttcctctttaacccctctgcttgccttgatgaacacttaatgcagtttaagttc
ttggggattttaatgggggttgccattcgcacaaagaagcctctggacctgcacctggcg
ccggtggtgtggaagcagctgtgctgcatcccgctcactctggaggacctggaggaggta
gacctgctctacgtgcagaccctcaatagcattcttcacattgaagacagcggcatcact
gaggagagcttccatgagatgattcctcttgattcttttgttggccagagtgcggatggc
aagatggtgcctataatccctggtggaaatagtatcccactcacgttttccaacaggaag
gagtatgttgagagggccattgaataccgactccatgagatggaccgacaggtggctgcg
gtccgagagggaatgtcctggattgtgcctgtgccgctgctgtccctgctcacggcgaag
caactggagcagatggtgtgcgggatgcccgacatctccgtggacgtcctgaagaaagtg
gtgcgctaccgcgaggtggacgagcagcaccagctggtgcagtggttctggcacacgctg
gaagagttctccaacgaggagcgcgtgctgttcatgcggtttgtgtcgggccggtctcgg
ctgccggccaacaccgctgacatttcccagcggtttcagatcatgaaggttgataggcct
tacgacagtctgcctacctcacagacgtgcttcttccagctgaggctgcccccctactcc
agccagctggtcatggccgagcgcctgcgctacgccatcaacaactgccgctccatcgac
atggacaactacatgctctcgaggaacgtggacaacgccgagggctccgacaccgactac
tga

DBGET integrated database retrieval system