KEGG   Oryctolagus cuniculus (rabbit): 100344814
Entry
100344814         CDS       T03373                                 
Symbol
ACVRL1
Name
(RefSeq) activin A receptor like type 1
  KO
K13594  activin receptor-like kinase 1 [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100344814 (ACVRL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100344814 (ACVRL1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100344814 (ACVRL1)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100344814 (ACVRL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS APH Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 100344814
NCBI-ProteinID: XP_017197361
Ensembl: ENSOCUG00000022530
LinkDB
Position
4:36071347..36085071
AA seq 377 aa
MALLVLLALGALGLWRVRRRQEKQRGLYSDLGESSLILKASEQGDSMLGDLVDSNCTTGS
GSGLPFLVQRTVARQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIY
NTVLLRHDNILGFIASDMTSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPQLALRLAVSA
ACGLAHLHVEIFGTQGKPAIAHRDLKSRNVLVKSNLQCCIADLGLAVMHSQGSDYLDIGH
NPRVGTKRYMAPEVLEEKIRTDCFESYKWTDVWAFGLVLWEIARRTIVNGIVEDYRPPFY
DVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGVVQMMRECWYPNPSARLTALRIK
KTLQKLSNSLEKPKAIH
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggccttgctggtcctgctggctctgggtgccctgggcctgtggcgcgtgcggcggagg
caggagaagcagcggggcctgtacagcgacctgggcgagtccagcctcatcctgaaggca
tccgagcaaggggacagcatgctgggggaccttgtggacagcaactgcaccacgggcagc
ggctctgggctccccttcctggtgcagaggacagtggcacggcaggtggccctggtggag
tgtgtggggaagggccgctacggagaggtgtggcggggcttgtggcacggtgagagtgtg
gccgtgaagatcttctcctcgagggacgagcagtcctggttccgggagacggagatctac
aacacggtgctgctgagacacgacaacatcctaggcttcattgcctcggacatgacctcc
cgcaactcgagcacgcagctgtggctcatcacgcactaccacgagcacggctcgctctac
gacttcctacagaggcagacgctggagccccagctggccctgaggctggcggtgtccgcg
gcctgcggcctggcgcacctgcacgtggagatcttcggcacgcagggcaaaccggccatc
gcccaccgcgacctcaagagccgcaatgtgttggttaagagcaacttgcagtgctgcatc
gcggacctgggtctggctgtgatgcactcccagggtagtgattacctggacatcggccac
aaccccagggtgggcaccaagcggtacatggcgcccgaggtgctggaggagaagatacgc
accgactgcttcgagtcctacaagtggacggacgtctgggcctttggcttggtgctgtgg
gagatcgcccggcggaccattgtcaatggcatcgtggaggactaccggccgccgttctac
gacgtggtgcccaatgaccccagcttcgaggacatgaagaaggtggtgtgtgtggaccag
cagactcccaccatccccaaccgcctggctgcagacccggtgctgtcaggagtggtacag
atgatgcgagagtgctggtaccccaacccctcggcccgcctcaccgcgctgcgcatcaag
aaaaccctgcagaagctcagcaacagcctggagaagccaaaagcgatccactag

DBGET integrated database retrieval system