KEGG   Oryctolagus cuniculus (rabbit): 100344852
Entry
100344852         CDS       T03373                                 
Symbol
MAP2K4
Name
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04668  TNF signaling pathway
ocu04912  GnRH signaling pathway
ocu04926  Relaxin signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05208  Chemical carcinogenesis - reactive oxygen species
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100344852 (MAP2K4)
   04012 ErbB signaling pathway
    100344852 (MAP2K4)
   04668 TNF signaling pathway
    100344852 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100344852 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100344852 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100344852 (MAP2K4)
   04926 Relaxin signaling pathway
    100344852 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    100344852 (MAP2K4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    100344852 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100344852 (MAP2K4)
   05161 Hepatitis B
    100344852 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100344852 (MAP2K4)
   05169 Epstein-Barr virus infection
    100344852 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100344852 (MAP2K4)
   05135 Yersinia infection
    100344852 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100344852 (MAP2K4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100344852 (MAP2K4)
   05418 Fluid shear stress and atherosclerosis
    100344852 (MAP2K4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100344852 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100344852 (MAP2K4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100344852 (MAP2K4)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE7 family
   100344852 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal ABC1 Haspin_kinase APH
Other DBs
NCBI-GeneID: 100344852
NCBI-ProteinID: XP_002718966
Ensembl: ENSOCUG00000010096
LinkDB
Position
19:complement(7536777..7658082)
AA seq 400 aa
MAAPSPSGGGGGSGGGSSSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARF
TLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKM
VHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICME
LMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDR
SGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYE
LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYK
ELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggcggctccgggggcggcagcagcagcggc
accccgggccccgtagggtctccggcgccgggccacccggccgtcagcagcatgcagggt
aaacgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggttt
actctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacac
agcattgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgct
gaggacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatg
gtccacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaa
aaagaacaaaagcaacttcttatggatttggatgtagtaatgcggagtagtgattgccca
tacattgttcagttttatggtgcactcttcagagagggtgactgttggatctgcatggaa
ctcatgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgtt
attccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccactta
aaagaaaacttgaaaatcattcacagagatatcaaaccttccaatattcttctggacaga
agtggaaatattaaactctgtgactttggcatcagtggacagcttgtggactccattgcc
aagacaagagacgctgggtgtaggccttacatggcacctgaaagaatagacccaagtgca
tcacgacaaggatatgatgtccgctctgatgtctggagtttggggatcacgttgtatgag
ttggccacaggccgatttccttatccaaagtggaatagtgtatttgatcagctaacacaa
gtcgtgaaaggagatcctccacagctgagtaattctgaggagagggaattctccccaagt
ttcatcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaa
gaacttctgaaacatccctttattttgatgtatgaggaacgtaccgttgaggtcgcatgc
tatgtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgat
tga

DBGET integrated database retrieval system