KEGG   Oryctolagus cuniculus (rabbit): 100344917
Entry
100344917         CDS       T03373                                 
Symbol
BMP5
Name
(RefSeq) bone morphogenetic protein 5
  KO
K04663  bone morphogenetic protein 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100344917 (BMP5)
   04390 Hippo signaling pathway
    100344917 (BMP5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100344917 (BMP5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100344917 (BMP5)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100344917 (BMP5)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta YkuD_2
Other DBs
NCBI-GeneID: 100344917
NCBI-ProteinID: XP_002714561
Ensembl: ENSOCUG00000025226
UniProt: G1TTC3
LinkDB
Position
12:complement(45669664..45794634)
AA seq 454 aa
MHLTAFLLRGIVAFLWSCWVLVGYSKGGLGDNHVHSSFIYRRLRNHERREIQREILSILG
LPHRPRPFSPGKQASSAPLFMLDLYNAMANEENPEESEYSVRASLAEETRGARKGYPASP
NGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEF
RFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKA
QALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRHGPQSKQPF
MVAFFKASEVLLRSVRAASKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYV
SFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA
PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcatctgactgcatttttacttaggggtattgtggcttttctctggagctgctgggtt
ctagtgggttattcaaaaggaggcttgggagacaatcatgttcactccagttttatttat
agaagactacggaaccacgaaagacgggaaatacagagggaaattctctctatcttgggt
ttgcctcacagacccagaccattttcacctggaaaacaagcgtcgtctgcgcctctcttt
atgctggacctgtacaatgccatggccaatgaagaaaatccagaagagtcggaatactca
gtgagggcatccctggcagaagagaccagaggggcaagaaagggatacccagcctctccc
aatgggtatcctcgccgtatacagttatctcgaacaacgcctctgaccacccagagccct
cctctagccagcctacatgataccaactttctgaatgatgcagacatggtcatgagcttt
gtcaacttagttgaaagggacaaggatttttctcaccagcgaaggcattacaaagaattt
cgctttgatcttactcaaattcctcacggagaagcagtgacagccgctgaattcaggata
tacaaggatcggagcaataatcgattcgaaaatgaaacaattaagattagcatatatcag
atcatcaaggaatacacaaatagagatgcagatttgttcctgttagacacaagaaaggcc
caagctttagatgtgggttggcttgtctttgatatcaccgtgaccagcaatcattgggtg
attaatccacagaacaatctgggcttacagctctgtgctgaaacaggggatggacgcagt
atcaacgtaaaatccgctggtcttgtgggaagacatggacctcagtcaaaacaaccgttc
atggtggcctttttcaaggcgagtgaggtacttcttcgatctgtgagagcagccagcaaa
cggaaaaatcaaaaccgcaataaatccagctctcatcaggactcctctagaatgtccagt
gttggagattataataccagtgaacaaaaacaagcctgtaagaagcacgaactgtatgtg
agcttccgcgatctggggtggcaggactggattatagcaccagaaggatatgctgcattt
tattgtgatggagaatgctcttttccacttaatgctcacatgaatgccaccaaccatgca
atagttcagaccctggttcatctgatgtttcctgaccacgtaccaaagccttgttgtgca
cccaccaaattaaatgccatatctgttttgtattttgatgacagttccaatgtcattttg
aaaaaatacagaaatatggtagtacgctcatgtggctgccactaa

DBGET integrated database retrieval system