KEGG   Oryctolagus cuniculus (rabbit): 100344938
Entry
100344938         CDS       T03373                                 
Symbol
TM9SF1
Name
(RefSeq) transmembrane 9 superfamily member 1
  KO
K12194  charged multivesicular body protein 4A/B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03250  Viral life cycle - HIV-1
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    100344938 (TM9SF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100344938 (TM9SF1)
  09143 Cell growth and death
   04217 Necroptosis
    100344938 (TM9SF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100344938 (TM9SF1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100344938 (TM9SF1)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100344938 (TM9SF1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100344938 (TM9SF1)
  Exosomal proteins of other body fluids (saliva and urine)
   100344938 (TM9SF1)
  Exosomal proteins of colorectal cancer cells
   100344938 (TM9SF1)
SSDB
Motif
Pfam: Snf7
Other DBs
NCBI-GeneID: 100344938
NCBI-ProteinID: XP_002718145
Ensembl: ENSOCUG00000002895
UniProt: G1SIL1
LinkDB
Position
17:complement(44232000..44257528)
AA seq 279 aa
MERRLGPRRRRARGRVLMMSRRARRRDWPGPAPGEETRPARSKAEVWERRGAEGRGEVAM
SGLGRLFGRGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKHGTKNKRA
ALQALRRKKRLEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAARGMKKAYQDMD
IDKVDELMADITEQQEVAQQISDAISRPVGFGDDVDEDELLEELEELEQEELAQELLNVG
DKEEESPVKLPSVPSARLPTAPKADEDEEALKQLAEWVS
NT seq 840 nt   +upstreamnt  +downstreamnt
atggagcggcggctgggcccgcgacggcggcgggcccgcgggcgcgtgctgatgatgtcg
cggcgcgcccggaggagggattggcccgggccggctccgggcgaggagactcggcctgcc
aggagcaaggcggaagtgtgggagcgccgaggggcggaggggagaggcgaggtcgccatg
agtgggctcggcagactcttcgggagggggaagaaggagaaggggccaacccctgaagaa
gcaatacagaaactgaaggaaacagagaaaatactgatcaagaagcaggagtttctggag
cagaagattcaacaggagctgcagacggccaagaagcatgggaccaagaataagagagct
gccctgcaggctttgcggaggaagaagagattggagcagcagctggcgcaaactgacggg
acgctgtccaccctggagttccagcgggaggccattgagaatgccaccaccaacgcagaa
gtgctgcggaccatggagctggctgcccgcggcatgaagaaggcctaccaggacatggac
attgacaaggtggatgaactgatggcggacatcacagaacaacaggaggtggcccagcag
atctcagatgccatttctcggcctgtgggctttggagatgacgtggatgaggatgaactg
ttggaggaactggaggaacttgaacaggaagagttggcccaggagttgttaaatgttggc
gacaaggaggaagaatccccggtcaaattgcctagtgttccctctgcacgtctgcctaca
gctcccaaagcggatgaagatgaagaagcactaaagcagttggctgagtgggtatcgtga

KEGG   Oryctolagus cuniculus (rabbit): 100347474
Entry
100347474         CDS       T03373                                 
Symbol
CHMP4C
Name
(RefSeq) charged multivesicular body protein 4C
  KO
K24782  charged multivesicular body protein 4C
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347474 (CHMP4C)
  09143 Cell growth and death
   04217 Necroptosis
    100347474 (CHMP4C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347474 (CHMP4C)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100347474 (CHMP4C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100347474 (CHMP4C)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100347474 (CHMP4C)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100347474 (CHMP4C)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100347474 (CHMP4C)
  Exosomal proteins of colorectal cancer cells
   100347474 (CHMP4C)
SSDB
Motif
Pfam: Snf7 DUF2981 Halogen_Hydrol
Other DBs
NCBI-GeneID: 100347474
NCBI-ProteinID: XP_002710707
Ensembl: ENSOCUG00000006847
UniProt: G1SRU4
LinkDB
Position
3:97374900..97401662
AA seq 233 aa
MSKLGKFFKGGGSSKSRAAPSPQEALARLRETEEMLSKKQEYLENRIQRELSLAKKHGTQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAARAMKAAH
ENMDLNKIDDLMQEITEQQDIAHEISEAFSQRVGFVDGFDEDELLAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPERKASRVPAAHRSRAASSRRTGEEDDDIKQLAAWAT
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcaagttgggcaagttctttaaagggggaggctcttctaagagccgcgctgccccc
agcccccaggaggccctggcccgacttcgggagaccgaggagatgttgagcaagaaacag
gagtacctggaaaatcggatccagagagaactctccctggccaagaagcacggcacgcag
aacaagcgagctgccttgcaggccctaaagagaaagaagaggtttgagaagcagctcact
cagattgatggcacgctctccaccatcgaattccagagagaagccttggaaaactcacac
accaacaccgaggtgttaaggaacatgggctttgcagcaagagcaatgaaagcggcccac
gaaaacatggatctgaacaaaatagatgatttgatgcaagagatcacagagcaacaagat
atcgcccacgagatctctgaagcattttctcaacgggtcggatttgttgatggttttgat
gaggatgaactgttggcagaacttgaagaattggagcaggaggaattaaataagaagatg
acaaatatccgacttccaaatgtgccttcctcttctcttccggcacaaccagaaagaaag
gccagcagggttcccgctgcacatcgatcccgagcagcttcttccaggaggacaggagaa
gaagatgatgatatcaaacagttggcagcttgggctacttaa

KEGG   Oryctolagus cuniculus (rabbit): 100347889
Entry
100347889         CDS       T03373                                 
Symbol
CHMP4B
Name
(RefSeq) charged multivesicular body protein 4B
  KO
K12194  charged multivesicular body protein 4A/B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03250  Viral life cycle - HIV-1
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    100347889 (CHMP4B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100347889 (CHMP4B)
  09143 Cell growth and death
   04217 Necroptosis
    100347889 (CHMP4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100347889 (CHMP4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100347889 (CHMP4B)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100347889 (CHMP4B)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100347889 (CHMP4B)
  Exosomal proteins of other body fluids (saliva and urine)
   100347889 (CHMP4B)
  Exosomal proteins of colorectal cancer cells
   100347889 (CHMP4B)
SSDB
Motif
Pfam: Snf7 SYF2
Other DBs
NCBI-GeneID: 100347889
NCBI-ProteinID: XP_002710845
Ensembl: ENSOCUG00000014543
UniProt: G1U2E3
LinkDB
Position
4:complement(5856171..5910961)
AA seq 224 aa
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSIALPSKPTKKKEEEDDDMKELENWAGSM
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtcggtgtttgggaaactgttcggggctggagggggtaaggccggcaagggcggcccg
accccccaggaggccatccagcggctgcgggacacggaggagatgctaagcaagaagcag
gagttcctggagaagaaaatcgagcaggagctgacggctgccaagaagcacggcaccaaa
aacaagcgcgcggccctccaggctctgaagcgcaagaagaggtatgagaagcagctggca
cagatcgacggtacgctgtccaccatcgagttccagcgggaggccctggagaatgccaac
accaacaccgaggtgctcaagaacatgggctacgccgccaaagccatgaaggcagcccac
gacaacatggacatcgataaagtcgatgagctaatgcaggacattgctgaccagcaagaa
cttgcagaggagatttccacagctatttccaaacctgtaggctttggagaagagtttgac
gaggatgaactcatggctgaattggaagaactagaacaggaggagctagacaagaatttg
ctggaaatcagtggacccgaaacagtccctctaccaaatgttccttctatagccctaccg
tcaaaacccaccaagaagaaggaagaggaagacgacgacatgaaggaattggagaactgg
gccggatccatgtaa

DBGET integrated database retrieval system