KEGG   Oryctolagus cuniculus (rabbit): 100344973
Entry
100344973         CDS       T03373                                 
Symbol
FANCL
Name
(RefSeq) Fanconi anemia complementation group L
  KO
K10606  E3 ubiquitin-protein ligase FANCL [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03460  Fanconi anemia pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100344973 (FANCL)
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100344973 (FANCL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100344973 (FANCL)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100344973 (FANCL)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100344973 (FANCL)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100344973 (FANCL)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     100344973 (FANCL)
SSDB
Motif
Pfam: FANCL_d3 FANCL_C FANCL_d2 FANCL_d1 zf-RING_2 zf-HC5HC2H
Other DBs
NCBI-GeneID: 100344973
NCBI-ProteinID: XP_002709902
Ensembl: ENSOCUG00000005105
LinkDB
Position
2:127928032..127999922
AA seq 375 aa
MAGTEASLLRQFPLLLPQNRAKTVYEGFISAQGRDFHLRILLPEDLQMKNARLLCSWQLK
TILNGYHQIVQQRMQHSPDLMSFMMELKMILGVALKNSQEIPVLTSPPQFYSSLIEEIGT
LGWDKLVYVDSCFSTIKLKAEDASGREHLLTLKLKAKYPAESPDCFVDFPVPFPVSWTPQ
SSLVSIHSQFLAALESLKAFWDVMDEIDEKTWVLEPEKPTRSATARRIAIGNNVSINIEV
DPKHPTMLPECCFLGADHVVKPLGIKLSRNIHLWDPENSLLQNLKDVLEIDFPARATLEK
SDFTMDCGICYSYQLGGVIPDQVCDNPQCGQPFHQICLYEWLRGLLTSRQSCNIMFGECP
YCSKPITLKMSGKKP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggcggggacggaagcgagcctgttgcgccagttcccgctacttctgcctcagaaccgg
gcgaaaactgtgtatgagggattcatttcggctcagggaagagacttccaccttagaata
ttgttgcctgaagatttgcaaatgaagaatgcaagattactatgcagttggcagctgaaa
actatacttaatggataccatcaaatagtccaacagagaatgcagcactctcctgaccta
atgagttttatgatggagttgaagatgattttgggagttgctttaaagaattctcaggag
atacctgtgctaacttcacctccccagttctattcaagccttattgaagagataggaact
cttggttgggataaacttgtgtatgtggattcttgcttcagtaccatcaagttaaaagca
gaagatgcttctggtagagagcatctactcaccctcaagttaaaggcgaagtaccctgca
gaatcaccagattgttttgtggattttcctgttccatttcctgtttcttggacaccgcag
agctctttagtaagtattcatagtcagtttttggcagcgttagaatcactgaaggcattc
tgggatgttatggatgaaattgatgagaagacctgggtacttgagccagagaaacctaca
cggagtgcaacagcacgcagaattgcaatagggaataatgtttccataaatatagaggta
gaccccaaacatcctactatgcttcctgaatgctgctttcttggtgctgaccatgtggta
aagcccctaggaattaagttgagcaggaacatacatttgtgggatccagaaaacagtctg
ttacaaaatttgaaagatgttttagaaattgactttccagctcgtgctaccctggaaaaa
tctgattttactatggattgtgggatttgttatagctatcaacttggtggtgtcattcct
gatcaagtgtgtgacaatccccagtgtggacaaccttttcatcaaatatgtttgtatgag
tggttaagaggcctactcaccagtagacagagttgtaacatcatgtttggtgaatgccca
tattgtagtaagccaattaccttgaaaatgtctgggaagaaaccctga

DBGET integrated database retrieval system