KEGG   Oryctolagus cuniculus (rabbit): 100345030
Entry
100345030         CDS       T03373                                 
Symbol
PARD3
Name
(RefSeq) par-3 family cell polarity regulator
  KO
K04237  partitioning defective protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04080  Neuroactive ligand-receptor interaction
ocu04144  Endocytosis
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04520  Adherens junction
ocu04530  Tight junction
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100345030 (PARD3)
   04390 Hippo signaling pathway
    100345030 (PARD3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100345030 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345030 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100345030 (PARD3)
   04530 Tight junction
    100345030 (PARD3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100345030 (PARD3)
  09158 Development and regeneration
   04360 Axon guidance
    100345030 (PARD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100345030 (PARD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100345030 (PARD3)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100345030 (PARD3)
SSDB
Motif
Pfam: PDZ PDZ_6 Par3_HAL_N_term PDZ_2 Peptidase_M50 CBM_14
Other DBs
NCBI-GeneID: 100345030
NCBI-ProteinID: XP_008272948
Ensembl: ENSOCUG00000000455
LinkDB
Position
Un
AA seq 1254 aa
MSDVSVLLQDPSYWIQVHRLEHGDGGILDLDDVLCDVVDDKDRLVAVFDEQDPHHGGDGT
SASSTGTQSPELFGGELGPSGASAFQPYQAPSEIEVTPSVLRTNMPLHVRRSSDPALVGL
STSLSDNHFSSEEPSRKNPTRWSTTAGFLKQSPSGGPNTCDRKKDENYRSLPRDTSSWSQ
FQRDNARSSLSASHPLVDKWLEKQEQEEDGVEEDSSRVEPLGHADTGSENIPSFSLDDMV
KLVQVSNDGGPLGIHVVPFSARGGRTLGLLVKRLEKGGKAEHEGLFHENDCIVRINDGDL
RNRRFEQAQHMFRHAMRTPVIWFHVVPAAKKEQYELLSQSESRQACASRLSPDSPGAADG
RAGGGGLGLPGPARAPRPSEPADAHPRLPPSAPHAYSAKKVGRRLHIQLKKGSEGLGFSI
TSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLVEVNGVDIAGKSQEEVVSLLRSTK
MEGTVSLLVFRQEDAFHPRELNAEPRQTQIPKETKAEDEDIVLTPDGTREFLTFEVPLND
SGSAGLGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGRTN
QDAMDALRRSMSTEGNKRGMIQLIVARRVSKGGQLKSPGSPAGPELPIETVLEDSERRIS
HSLYSGIEELEESPARSAALGRIVGKFQLSPTVNMSHDDSVIIEDDRLPVLPPQLSDQSS
SSSHDDMGFVTTEVATWAKAAISDSADCSLSPDVDPVLAFQREGFGRQIADETKLNTVDD
QTSGSPSRDVGPSLGLKKSSSLESLQTAVAEATLNGDIPFHRPRPRIIRGRGCNESFRAA
IDKSYDKPVADDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQTNGNQERGDKT
DRKRDKTGKEKKKDRDKEKDKMKAKKGMLKGLGDMFRFGKHRKDDKIEKTGRIKMQETFT
SEEERTRMKQERERIQAKTREFRERQARERDYAEIQDFHRTFGCGEESMYGGLSPYEGSL
ALNARPQSPREGHLMDALYAQVKKPRNPKPSPVDSRAAPSNHDRIQRLRQEFQQAKQEED
AEDRRRTYSFEQPWPSSRPAAQSGRHSVSVEVQVQRQRQEERDSFQQAQRQYSSLPRQSR
KNASCVSQDSWEQSCPPGEAFQSAKDSPRYSSYQGSKNGYLGGHGFNARVMLETQELLRQ
EQRRKEQQMKKLPAPEGAYAPAKGPFRQDVPPSPSQVARLSRLQTPEKGRPFYS
NT seq 3765 nt   +upstreamnt  +downstreamnt
atgtccgatgtgtctgttcttctgcaggacccgagctactggatacaggtgcaccgcctg
gagcatggagacggagggatcctagacctggacgacgtgctctgtgatgtggtggacgac
aaggacaggctggtggcggtgtttgacgagcaggatccccaccacggaggcgatggcacc
agcgccagctccacgggtacccagagcccggagctgtttgggggcgagctgggccccagc
ggcgcgtcggccttccagccctaccaggccccgagcgagattgaggtcacgccctccgtc
ctgcgcacaaatatgcctctgcatgtgcgccggagcagcgaccccgccctcgtgggcctg
tcgacctcactcagcgacaaccacttctcctccgaggagccctccaggaagaaccccacg
cgctggtccacgacagccggcttcctcaaacagagcccatcgggtggtcccaacacctgc
gacaggaagaaagacgagaactaccggagcctgccgcgggacacgagcagctggtcccag
ttccagagggacaacgcacggtcatctctgagcgccagccacccgctggtggacaagtgg
ttggagaagcaagaacaggaggaggatggtgtggaagaggacagcagccgcgttgagccc
ctgggacacgccgacactggctcagagaacatccccagcttctccctggatgacatggta
aagctcgtacaagtctccaacgatggcgggcccctggggatccatgtagtgcccttcagt
gctcgaggtggcagaacgctaggcttgctggtgaagcggctggagaaaggtgggaaggct
gagcacgagggcctcttccacgagaacgactgcatcgtcaggatcaacgatggcgacctt
cgcaacagaagatttgagcaggcgcagcacatgttccgccacgccatgcgcacgcccgtc
atctggttccacgtggtgcccgccgccaagaaggagcagtacgagctgctgtcgcagagc
gagagccgccaggcctgcgccagccgcctcagccccgacagcccgggcgcggccgacggc
agggcggggggcggcggcctggggctccccggccctgcccgcgcgccccggccctccgag
cccgccgacgcccacccgcgactgccgcccagcgcgccgcacgcctacagcgccaagaag
gtcggccggcgcctgcacatccagctcaagaaaggttcagagggcttggggttcagcatc
acttcccgcgacgtgacgataggtggctctgcccccatctacgtgaagaacatcctccct
cgcggcgcggccatccaggacggccggctcaaggccggagaccggctggtggaggtgaac
ggagtagacatcgcgggcaagtcccaggaggaggtggtgtccctgctgagaagcaccaag
atggaggggaccgtgagcctcctggtcttccgccaggaggacgccttccaccccagggag
ctgaatgcagagccaaggcagacgcagattcccaaagaaacgaaagcggaagacgaggat
atcgtgctcactcccgacggcaccagggagttcctgacgtttgaagttcccctcaacgac
tcggggtctgcggggctgggtgtcagcgtcaagggcaaccgctccaaagagaaccacgcg
gacctgggcatcttcgtcaagtccatcatcaatgggggtgccgcctctaaagatgggcga
ctccgtgtgaatgaccagctgatcgccgtgaacggggagtccctgttgggcaggacgaac
caggacgccatggatgccctcaggagatccatgtccaccgagggcaacaagcggggcatg
attcagctcatcgtggcgcggcgtgtcagcaagggcgggcagctgaagtcacctgggagc
cctgctggaccggagctgcccatcgaaacagtgttggaagacagcgagcggcggatttcg
cactcgctctacagtggcatcgaggagctggaggagtcgcccgcgaggagcgctgctctc
ggtcggatcgtgggtaaattccagctgtcccccactgtgaacatgtcccacgacgacagc
gtcatcatcgaagacgaccggctgcctgtgctcccgccgcagctctccgaccagtcctcg
tccagctcccacgacgacatgggcttcgtgaccacagaggtggccacgtgggccaaggct
gccatcagtgattcagccgactgctctctgagtccagatgttgatccagttcttgctttt
caacgagaaggatttggacgccagatagctgacgagactaaactcaatacagtggatgac
cagacatcaggctcccccagcagagacgtggggccctccctgggcctgaagaagtccagc
tccctggagagcctgcagacggccgtggccgaggcgaccctcaatggggacattcctttc
caccgcccccggccgcgcatcatccgaggaaggggctgcaacgagagcttccgggcggcc
atcgacaaatcctatgacaagcccgtggccgacgacgatgatgaaggcatggagaccttg
gaggaagacacggaagaaagctctcggtcaggaagagagtctgtgtccacagccagcgac
cagccgtcccactccctggagagacagacaaacggcaaccaggagaggggtgacaagacc
gacaggaaaagggataagaccgggaaagagaagaaaaaagacagagacaaagaaaaggac
aaaatgaaagccaagaaaggcatgctgaagggcttgggagacatgttcaggtttggcaaa
catcgaaaagatgacaagattgagaaaacgggtagaataaaaatgcaggaaacctttacg
tcagaagaggagaggacacgaatgaagcaggaacgggagaggattcaagccaaaacccga
gaatttagggagcgacaggctcgggagcgcgactatgccgagatccaggattttcaccgg
acgttcggctgtggtgaggagtcgatgtacgggggcctttctccctatgagggctccctg
gccctcaacgccaggccccagagcccgagagaaggacacctgatggatgctctctatgca
caagtgaagaagccgcggaaccccaaaccttcacccgtggacagccgagccgcccctagc
aaccacgaccggatacagcgtctgcggcaggagttccagcaggccaagcaggaggaggac
gcggaggaccggcggcgcacctacagcttcgagcagccctggcccagctcccggccggct
gcgcagagcggcagacactcggtgtcggtggaggtgcaggtgcagcggcagcggcaggag
gagcgggacagcttccagcaggcccagcgccagtacagctccctgccgaggcagagcagg
aagaacgccagctgcgtgtcgcaggactcgtgggagcagagctgcccgccgggggaggcc
ttccagagcgccaaggacagcccgcgctactccagctaccagggctccaagaacggctac
ctgggcggccacggcttcaacgccagggtcatgctggagacgcaggagctgctgcgccag
gagcagcggcgcaaggagcagcagatgaagaagctgccagcccccgagggcgcctacgcc
cccgccaagggccccttccggcaggacgtgcccccgtcgccctcacaggtggcccggctc
agcagactgcagactcccgagaaggggcggcccttctactcctga

DBGET integrated database retrieval system