KEGG   Oryctolagus cuniculus (rabbit): 100345068
Entry
100345068         CDS       T03373                                 
Symbol
ACVR1B
Name
(RefSeq) activin A receptor type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100345068 (ACVR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100345068 (ACVR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100345068 (ACVR1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100345068 (ACVR1B)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100345068 (ACVR1B)
Protein kinases [BR:ocu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   100345068 (ACVR1B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp APH Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 100345068
NCBI-ProteinID: XP_017197362
Ensembl: ENSOCUG00000017934
LinkDB
Position
4:36120589..36154742
AA seq 453 aa
MVSIFNLDGIEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDFCNKIDLRVPSGH
LKEPEHPSMWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMC
LSKDKTLQDLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVA
VKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFD
YLNRYTVTIEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIA
DLGLAVRHDAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWE
IARRCNSGGVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNVPNWWQSYEALRVMGKM
MRECWYANGAARLTALRIKKTLSQLSVQEDVKI
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggtgtccattttcaacctggacgggattgagcaccatgtgcgcacctgcatccccaag
gtggagctggtgcccgccgggaagccgttctactgcctgagctcggaggacctgcgcaac
acccactgctgctacacggacttctgcaacaagatcgacctgcgggtgcccagtggccac
ctcaaggagcccgagcacccgtccatgtggggccccgtggagctggtgggcatcatcgcc
ggccccgtgttcctgctctttctcatcatcatcatcgtcttcctcgtcattaactaccat
cagcgtgtctaccacaaccgccagagactggacatggaggacccctcctgcgagatgtgc
ctgtccaaggacaagacgctgcaggacctcgtctacgatctctccacctcgggctccggc
tcagggctgcccctatttgtccagcgcacagtggcccgaaccattgttttacaggagatt
atcggcaaaggccgctttggggaggtgtggcgcggccgctggcggggcggcgacgtggct
gtgaaaatcttctcttcccgcgaagagcgctcctggttccgggaggctgagatctaccag
acggtcatgctgcgccacgagaacatcctgggcttcatcgccgccgacaacaaagataac
ggcacgtggacgcagctgtggctggtttccgattaccacgagcatggctcgctgttcgat
tacctgaaccggtacacggtgaccatcgagggcatgatcaagctggccctgtcggctgct
agtgggctggcgcacctgcacatggagatcgtggggacccaagggaagccggggattgct
caccgggacttgaagtccaagaacatcctggtgaagaagaacggcatgtgtgccatcgca
gacctgggcctggctgtgcgccacgacgccgtcaccgacaccatcgacattgcccccaac
cagagggtgggcaccaagcggtacatggccccggaagtactggacgaaaccatcaacatg
aagcactttgattcgttcaagtgtgccgacatctatgccctcgggctggtgtactgggag
attgcccgacggtgcaactctggaggagtccacgaggagtatcagctgccgtattacgac
ttggtgccgtccgacccctccatcgaggagatgcggaaggttgtttgtgaccagaagcta
cgtcccaatgtccccaactggtggcagagctacgaggcgctgcgggtgatgggcaagatg
atgcgggagtgttggtacgccaacggtgcggcgcgcctcaccgccctgcgcatcaagaag
acgctgtcccagctcagcgtgcaggaggatgtgaagatctag

DBGET integrated database retrieval system