KEGG   Oryctolagus cuniculus (rabbit): 100345084
Entry
100345084         CDS       T03373                                 
Symbol
CUL7
Name
(RefSeq) cullin 7
  KO
K10613  cullin 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100345084 (CUL7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100345084 (CUL7)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100345084 (CUL7)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul7 complex
    Cullin
     100345084 (CUL7)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   3M complex
    100345084 (CUL7)
SSDB
Motif
Pfam: Cul7 Cullin ANAPC10 Cullin_Nedd8 F5_F8_type_C
Other DBs
NCBI-GeneID: 100345084
NCBI-ProteinID: XP_008261154
Ensembl: ENSOCUG00000001578
LinkDB
Position
12:complement(32526691..32544272)
AA seq 1687 aa
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDEGEAGSGQVDC
KAEHILLWMSNDEIYANCHKMLDEDGQVVGPSQESAAETGALDKSVLGEMETDVKSLIQR
ALRQLEECVGATPPAPLLHTVHVLSAYASIEPLTGIFKDPRVLDLLMRMLNSPDYQIRWS
AGRMIQALSSHDAGTRTQILLSLSQQEAIEKQLDFDSRCALLALFAQATLAEHPMSFEGI
QLPQVPGRLLFSLVKHYLHVTSLLDQLNDNAGESGAQNNSAPEDLSGDRARLELEYSMAM
GTLISELVQAMRWDRAWNRPGSSPRSPCSIFQPQVADGDPQLPPTEAQPALRRSRRFRPR
SQFASGNTYALYVRDTLEPGMRVRMLDNFEEISAGDEGEFQQSNSGVPPAQVFWESTGRT
YWVHWHMLEILGFEEDMEDMVEADEYQRAMISGALDRALPSLRWKPMTELHAAPYVPPED
EDAEEREHLTQAEWWELLFFVRKLGESDHQDVLQLLQENLDGEHILDDEILAELVVPIEL
AQDLLLSLPQKLDDSALRDLLNCRIYRKYGPEALLGQVAYASSVEAERDVLLEARAPPQE
SEDTARAQAKEAPCKSPESPLQRLAEDCGPTGKILLDLEQALSSESSRQHAVPPLLLQLQ
RQPQPFLALMESLGTPATNRALHLTALRILKQLVDFPDALLLPWHEAMSACMACLRSPNT
DREVLQELIVFLHHLTSASRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDVVFKCE
KHAHLYRKLITNILGGCIQMVLGQIEDHRRTHRPINIPFFDVFLRYLCQGSSMGENEDKC
WEKVEVSSNPHRASKLTDRNPKTYWESSGSAGSHFITLHMRQGVLIRQLILLVAGEDSSY
MPARVVVCGGDNASSLTTELNSVNVMPCASRVILLENLTHPWPVIQIRIKRCQQGGIDTR
IRGVEVLGPKPTFWPVFREQLCRHTRLFYMVRAQAWSQDIAENRRSLLHLSSRLNGALRQ
EQNFADYFLPDDEAAQALGKTCWEALVSPLVQNITSPDEDGISPLGWLLDQYLECREAAH
NPQSRAAAFSSRVRRLTHLLVHVEPCQAPPPVVATPRPKGRNRSHDWSSLATRGLPSSIM
RNLTRCWRAVVEEQVHSFLTSHWRDDDFVPRYCEHFYNLQKSSSELFGPRAAFLLALQNG
CAGALLKLPFLRAAHVSEQFARNIDQRIQGSRIGGTRGMEMLAQLQRCLESVLIFSGLEI
ATTFEHYYQQYMSDRLLGVGSSWLEGAVLEQIGSCFPNRLPQQMLRSLSTSEELQRQFHV
YQLQRLDQELLRLEDAEKKIQVGQEASSQECESKKKEAAGAVAALDLGEEEENEDLYYEG
VMPEVSVLVLSPRCWPVASICHTMDPRICLPAYLRGTLNRYSNFYNRSRGMQRRLQWTWL
GQAELQFGDQTLHVSTVQMWLLLYFNDLKAVCVDSLLALSGLSADLLNQAIGPLTSSRGP
LDFHEQENIPGGVLKVRDTSEEPRPRRGSVWLIPPQTYLRAEDEGGRNLEKRRNLLNCLI
VRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLLSSLGKGSACSSTDVLSCILHLLSK
GTLRRHDDRPQTLAYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCSGT
QSFSTFR
NT seq 5064 nt   +upstreamnt  +downstreamnt
atggtgggagaactccgctacagggaattcagggtccccctggggcccggcttgcacgcc
tatcctgatgagttgatccgccagcgcgtgggccacgacggccaccccgagtaccagatc
cgctggctcatcctcaggcgtggggatgagggggaagcgggctctggccaagtggactgc
aaagctgagcacatcctgctgtggatgtccaacgatgagatctacgccaactgccacaag
atgctggacgaggacggccaggtggtcgggccctcgcaggagtccgcggcggagactggg
gccctggacaagtctgtgctgggcgagatggagacggacgtgaagtctctgatccagagg
gccctccggcagctggaggagtgtgtgggcgccacccctcctgcgcctctgcttcacacg
gtgcacgtgctcagcgcctacgccagcatcgagcccctcactggcatattcaaagacccc
agggtcctggacttgctcatgcgtatgttgaatagtcccgattatcagatccgctggagc
gcaggccggatgatacaagccctgtcctcccatgatgctgggacccggacccagattctt
ctgtcactgagccagcaagaggccattgagaagcagctggattttgacagccgctgtgct
ctgctagcactgtttgcacaggccacgctcgccgaacatcccatgtctttcgagggcatt
cagctgccacaggtcccgggaaggctgctcttctccctggtgaagcactatctgcatgtc
acctccctcctggatcagctgaacgacaatgctggagaatcgggcgcccagaacaactct
gctcctgaagacttgagtggggacagggctcggctggagctggagtacagcatggccatg
ggtaccctgatctcagagctggtgcaggccatgcgctgggaccgggcctggaacagacca
gggagctctccacggtccccctgttccatcttccagcctcaggtggcggatggggaccct
cagctcccacccaccgaggctcagcccgccctcaggcggtcaaggcggtttcgccctcgc
tctcagtttgcaagcggcaatacctacgccttgtatgtgcgggacacgctggagccgggg
atgcgcgtgcggatgctggataacttcgaggagatcagtgctggcgatgagggcgagttc
cagcagagcaacagcggtgtgccccctgcgcaggtattctgggagtcgacaggccgcacc
tattgggtgcactggcacatgctggagatcttaggctttgaggaagacatggaggacatg
gttgaagctgatgagtaccagagggcgatgatcagtggagctctggatcgagccctgccc
tccttgcgctggaagcccatgaccgagctccatgctgcgccttatgtgccgcccgaggat
gaggatgctgaggagagggagcacctgacccaggctgagtggtgggagctcctcttcttc
gtcaggaagttgggcgagtctgaccaccaggatgttctgcagctcctccaggagaacctg
gatggagagcatattctggatgacgagatcctggccgagctggtagtccccatagagttg
gcccaggacctgctgctgtctctgccacagaaacttgatgacagcgcccttagggacctg
ctcaactgccgtatctacaggaagtatgggcccgaagccctgttagggcaagtggcctac
gcatcctctgtagaagctgagcgagatgtcctgctggaagcccgggccccgccccaggaa
tcagaagacacagctagagctcaagccaaagaagccccttgtaagagccccgagtctcct
ctgcagcgtctggcagaggattgcggccccactgggaaaatcctcctggatctggagcaa
gcccttagctcagagagcagccggcagcatgcggtcccacccttactgctgcagctccag
cgtcagccccagcccttcctcgcactgatggagagcctcggcacgccagccaccaacaga
gccctgcacctgactgctctgagaatcctgaagcagctggtggacttccccgacgcactg
ctactgccctggcatgaggctatgagtgcctgcatggcttgcctgcggtccccaaacacc
gaccgagaggtgctccaggagctgatcgttttcctgcaccacctgacctcagcgagccgg
gactacgccgtggtgctgaaccagctgggagcccgagatgccatctccaaggccctggag
aagcatctggggaagctggagctggcgcaggagctacgggacgtggtgttcaagtgcgag
aagcatgcccacctgtaccggaaactcattaccaacattctggggggctgcatccagatg
gtgctaggccagattgaagaccacagacgaacccaccggcccatcaacatccccttcttt
gatgtgttcctcagatatctgtgccaaggctccagtatgggcgagaacgaggacaagtgc
tgggagaaggtggaggtgtcctccaacccgcaccgggccagcaagctgacggaccgcaac
cccaagacctactgggagtccagcggcagcgccggctcccacttcatcaccttgcacatg
cgccagggcgtcctcatcaggcagctgattctgctggtggctggcgaggactcaagctac
atgcctgcccgggtggtggtgtgcgggggcgacaatgcaagctctcttaccacggaactc
aactcagtgaatgtgatgccttgtgccagccgcgtgatcctcctggagaacctcacccac
ccttggcccgtcattcagatccgcatcaagcgctgccagcagggtggcattgacacgcgc
attcggggtgtggaggtgctggggcccaagcccacattctggccagtgttccgggagcaa
ctgtgtcgtcacacacgcctcttctacatggttcgcgcacaggcctggagccaagacata
gcagagaaccgtaggagcctcctgcacctgagttctcgactcaatggggctttgcgccag
gagcagaattttgctgattacttcctccctgatgatgaggctgcccaagcactgggcaag
acctgctgggaggccctggtcagccccctggtgcagaacatcacctcccccgatgaggat
ggcatcagccccctgggctggctgttggaccagtacttggagtgtcgggaggctgcccac
aatccccagagccgtgcggcagctttctcctcaagggtgcgccgcctcacccacctgctg
gtgcacgtggagccctgccaggcgcctcctccggtggtggccactcctcggcccaagggc
agaaacagaagccacgactggagctccctggccaccaggggccttcccagcagcatcatg
agaaatctgacgcgctgttggcgagccgtggtggaggagcaggtgcacagctttctgacc
tcacactggcgggacgacgattttgtgcctcgctactgtgagcacttctataacctgcag
aagtccagctctgagctgttcgggccacgggccgccttcctgctggcactgcagaacggc
tgtgctggggccttgctgaagctcccttttctcagagctgcccacgtgagcgagcagttt
gcccggaacattgaccagcggatccagggcagccggatcggtgggacgcgggggatggag
atgctggcacagctgcagcgatgcctagagtctgtcctcattttctctggcctggagata
gcgaccaccttcgagcattactaccagcagtatatgtcagaccgtctcctcggcgtgggc
tcgagctggctggagggggccgtgctggagcagattggttcctgcttccccaaccgcctc
ccgcagcagatgttgcggagcctgagcacctccgaggagctgcagcgccagttccacgtg
taccagctccagcggcttgaccaggagctgctgaggctggaggacgcggagaagaaaatc
caggtgggccaagaggccagcagccaggagtgtgagagcaagaagaaggaggctgctgga
gcagtagcggctttggatctgggggaggaagaagagaatgaggacctttattatgaaggg
gtgatgccagaagtgtctgtgctcgtcttgtccccccgctgctggcctgtcgcctccatc
tgccacacaatggaccccagaatctgcctgcccgcttacctgcggggcaccctgaaccga
tattccaacttctacaacaggagtcgcggaatgcagaggcgactgcagtggacgtggctg
ggccaggctgagctgcagtttggggaccagaccctgcacgtgtccaccgtgcagatgtgg
ctgctgctgtatttcaacgatctgaaggccgtctgcgtggacagcctgctggcgctctcc
gggctctctgcggacctgctgaatcaggcgatcgggcctcttacctcttctcgaggcccc
ttggacttccacgagcaagagaacataccaggaggggtgcttaaggttcgagacaccagc
gaggaacccaggccaaggaggggcagcgtgtggctcatcccgcctcagacctacctgaga
gctgaggacgaagggggccggaacttggagaagagacggaaccttctgaactgcctcatc
gtccgcatcctcaaggcccacggggacgaggggctgcacatcgaccagctcgtctgtctg
gtgctggaggcctggcagaagggcccgtgtccaccccggggcttgctcagcagccttggg
aagggctccgcctgcagcagcactgacgtcctctcctgcatcctgcacctgctgagcaag
ggcacactgagacgccacgatgaccggccccagacgctggcctacgcggtccccgtgact
gtgatggagcctcacacggagtccctgaacccgggctcctcaggccccaacccaccgctc
accttccacaccctgcagattcgctctcggggcgtgccctacgcctcctgctctggcacc
cagagcttttccaccttccggtag

DBGET integrated database retrieval system