KEGG   Oryctolagus cuniculus (rabbit): 100345109
Entry
100345109         CDS       T03373                                 
Symbol
SNF8
Name
(RefSeq) SNF8, ESCRT-II complex subunit
  KO
K12188  ESCRT-II complex subunit VPS22
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345109 (SNF8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345109 (SNF8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100345109 (SNF8)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-II complex
    100345109 (SNF8)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100345109 (SNF8)
SSDB
Motif
Pfam: EAP30 EutK_C MarR_2 RPA_interact_C Plasmid_RAQPRD DUF4896 Phage_Mu_Gam
Other DBs
NCBI-GeneID: 100345109
NCBI-ProteinID: XP_002719354
Ensembl: ENSOCUG00000009156
UniProt: A0A5F9CJH6
LinkDB
Position
19:38484769..38494824
AA seq 258 aa
MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRK
NPEFRVQFQDMCATIGVDPLASGKGFWSQMLGVGDFYYELGVQIIEVCLALKHRNGGLIT
LEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDH
TVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALF
TDLYSQEITAEEAREALP
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcaccgccgcggggtgggagccggcgccatcgccaagaagaagctggctgaggccaag
tataaggagcgagggactgtcttggcggaggaccagctggcgcagatgtcaaagcagctg
gacatgttcaagaccaacctggaggaattcgccagcaagcacaagcaggagatccggaag
aatcccgagttccgggtgcagttccaggacatgtgcgcgaccattggggtggatcctctg
gcctctggaaaaggattctggtcacagatgctgggagtgggggacttctattatgagctg
ggcgtccagattatcgaagtgtgcctggccctgaagcaccgcaatggaggtctgatcact
ctggaagagctacatcagcaggtgttaaagggaagaggcaagttcgcgcaggacgtcagc
caagatgacctcatcagggccatcaagaaacttaaggcgctcggcaccggcttcggcatc
atccccgtgggcggcacttacctcattcagtctgttccagctgaactcaacatggatcac
accgtggtgctgcagctggcagagaaaaatggttacgtgactgtaagtgaaatcaaagcc
agtcttaaatgggagaccgagcgtgcgcgccaagtgctggaacacctgctgaaggaaggg
ctggcctggctggacttgcaggccccaggagaggcccactactggctgccagctctcttc
actgacctctactcccaggaaatcacagctgaggaggccagagaagccctcccctga

DBGET integrated database retrieval system