KEGG   Oryctolagus cuniculus (rabbit): 100345191
Entry
100345191         CDS       T03373                                 
Symbol
EHD4
Name
(RefSeq) EH domain containing 4
  KO
K12477  EH domain-containing protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100345191 (EHD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345191 (EHD4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100345191 (EHD4)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100345191 (EHD4)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100345191 (EHD4)
SSDB
Motif
Pfam: DUF5600 EHD_N EF-hand_4 Dynamin_N MMR_HSR1 EF-hand_1 GTP_EFTU AAA_28 AAA_16 EF-hand_7 TsaE AAA_22
Other DBs
NCBI-GeneID: 100345191
NCBI-ProteinID: XP_002718009
Ensembl: ENSOCUG00000015759
UniProt: G1TA48
LinkDB
Position
17:30179178..30255452
AA seq 541 aa
MFSWMGRQAGGRERTGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFEN
KPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGDTEGSTPGNALVVD
PKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISIIDSPGILSGEKQRISRGYDFCQVLQW
FAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALM
WSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDL
IKRARLAKVHAYIISYLKKEMPNMFGKENKKRELISRLPEIYIQLQREYQVSAGDFPEVK
AMQEQLENYDFSKFHSLKPKLIEAVDNMLSTKIASLMSLISQEESSAPTQLVQGGAFDGT
AEGPFNQGYGEGAKEGADEEDWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLP
NSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSTLPPHLVPPSHRKSLPKA
D
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgttcagctggatggggcggcaggcgggcgggcgcgagcgcacaggcggcgcggacgcc
gtgcagacggtgaccggcggcctgcgctcgctctacctgcgcaaggtgctgccgctggag
gaggcgtaccgcttccacgagttccactcgccggcgctggaggacgccgactttgagaac
aagcccatgatcctgctggtgggccagtacagcacgggcaagaccaccttcatcaggtac
ctactggagcaggatttcccgggcatgaggattggcccggagcccaccaccgactccttc
atcgccgtgatgtacggggacaccgagggcagcacccccgggaacgccttggtcgtggac
cccaaaaagccatttcgaaagctcagtcgtttcggaaatgccttcctgaatcgattcatg
tgctcccagctacccaaccaggtcctgaagagcatcagcatcatcgacagccccggcatc
ctgtcaggagagaagcagcgcatcagccgaggctatgacttctgccaggtcctgcagtgg
ttcgccgagcgggtcgacaggatcatcctgctcttcgacgctcacaagctggacatctcg
gacgagttctcggaagccatcaaggccttccggggccaggacgacaagatccgtgtggtg
ctcaacaaggccgaccaggtggacacgcagcagctgatgcgggtgtacggggccctcatg
tggtccctaggcaaggtcatcaacacgcccgaggtgctgcgcgtgtacattggctccttc
tgggcacagcccctgcagaacaccgacaaccgccggctcttcgaggccgaggcccaagac
ctcttcagagacatccagagccttccccagaaggcagccgtgcgcaaactcaacgacctc
atcaagagagcgaggctggccaaggtgcacgcctacatcatcagctacctgaagaaggag
atgccaaatatgtttggaaaggaaaacaagaagcgggaactgatcagcagactgcctgaa
atctacattcagctgcagcgggaataccaggtgtccgcgggggacttccctgaggtcaag
gccatgcaggagcagctggagaactacgacttctccaagttccactcgctcaagcccaag
ctgatcgaggccgtggacaacatgctgagcaccaagatcgcgtccctgatgagcctcatc
agccaggaggagagcagcgcgcccacgcagctcgtgcagggcggcgccttcgacggcacc
gccgagggccccttcaaccagggctacggcgagggcgccaaggagggtgccgacgaggag
gactgggtggtggccaaggacaagcccgtctacgatgagctcttctacaccctgtcaccc
atcaatggcaagatctcgggcgtcaacgccaagaaggagatggtgacctccaagctgccc
aacagcgtgctgggcaagatctggaagctggccgactgcgactgcgatggcatgctggac
gaggaggagttcgcgctggccaaacacctcatcaagatcaagctcgacggctacgagctg
cccagcaccctgcccccccacctcgtgcccccctctcacaggaagtccctgccgaaggcc
gactga

DBGET integrated database retrieval system