KEGG   Oryctolagus cuniculus (rabbit): 100345196
Entry
100345196         CDS       T03373                                 
Symbol
CDC27
Name
(RefSeq) cell division cycle 27
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100345196 (CDC27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100345196 (CDC27)
   04114 Oocyte meiosis
    100345196 (CDC27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100345196 (CDC27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345196 (CDC27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100345196 (CDC27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100345196 (CDC27)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100345196 (CDC27)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100345196 (CDC27)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100345196 (CDC27)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100345196 (CDC27)
SSDB
Motif
Pfam: TPR_1 ANAPC3 TPR_2 TPR_8 TPR_12 TPR_11 TPR_17 TPR_16 TPR_19 TPR_14 TPR_9 TPR_6 ChAPs PPTA TPR_MalT TPR_20 Cas_Cas02710
Other DBs
NCBI-GeneID: 100345196
NCBI-ProteinID: XP_002719506
Ensembl: ENSOCUG00000010815
LinkDB
Position
19:complement(46557539..46643818)
AA seq 824 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL
PNTCTTLVSNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTPSVIDVPSSGAPTKKSVARIGQTGTKSVFSQSGNSREVTPILVAQTQSAGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAGLMSLLREMGKGYLALCSYN
CKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYS
TTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNY
AYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQK
ALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYK
SALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAID
KRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacccgtccaggctgctatttggcaagcactaaatcactatgct
tatcgagatgcagttttcctcgcagaacggctgtatgcagaagtgcactccgaagaagcc
ttgtttttactggcaacctgttattaccgctcaggaaaggcatataaagcatatagactc
ttgaaaggacacagttgtactacaccacagtgtaaatacctgcttgcaaaatgttgtgtt
gatctgagcaagcttgcagaaggggaacagatcttatctggtggagtatttaataagcag
aaaagccatgatgatatcgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtgtattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtctccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccagacctttaaattaacatctttacagaactttagcagctgtctg
cccaacacttgcacaacactagtatctaatcatagtttatctcacagacagcccgagaca
gttcttacagaaacaccccaggacacaattgaattaaacagactgaatttagaatcttca
aattcaaagtactccttgaatacagattcctcagtgtcttacattgattcagctgtgatt
tcaccagatactgtccctcttggaacaggaacttctatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagtttgttaggaggaccagctgctcttagcccattaaccccg
agttttgggattttgccattagaaaccccaagtcctggagacggatcctatttacaaaac
tacactaatacaccctctgtaattgacgtgccatccagtggagcccctacaaaaaagtct
gttgcaagaattggccaaactggaacaaagtctgtcttctctcagagtggaaatagtcga
gaggtaactccaattcttgttgcacaaacacaaagtgctggcccacaaacaagtacaaca
cctcaggtattgagccccactattacatctcccccaaacgcactgcctcgaaggagttct
cggcttttcaccagtgacagctctacaaccaaggagaatagcaaaaaattaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggcataact
caacctaatataaatgatagcctggaaattacaaaattggattcttccatcatttcagaa
gggaaaatatccacaatcacacctcagatccaggcttttaatctgcaaaaagcagcagca
ggtttgatgagccttcttcgtgaaatgggcaaaggttatttagctttgtgttcatacaac
tgcaaagaagctataaatattttgagccacctaccttctcaccactacaacactggttgg
gtactgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaaga
atattctcagaggttagaagaattgagaattacagagttgaaggcatggagatctactct
acgacactttggcatcttcaaaaagatgttgctctttcagttctttcaaaagacttaaca
gacatggataaaaattcaccagaggcttggtgtgccgcaggaaactgtttcagtctgcaa
cgggaacatgatattgcaattaaatttttccagagagctatccaggttgatccaaattat
gcttatgcctatactctattaggacatgagtttgtgttgactgaagaactagacaaagca
ttagcttgttttcgaaatgctatcagagtcaatcctagacattacaacgcatggtatggt
ttaggaatgatttattataagcaagaaaaattcagccttgcagaaatgcatttccagaaa
gcacttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcagcat
gcactgaaaaagtctgagaaggctttggataccctaaacaaagccattgttattgatccc
aagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataag
tctgctttacaagaacttgaagaattgaagcaaattgttcccaaagaatcccttgtttac
ttcttaataggaaaggtttacaagaaattaggtcagacacacctcgccctgatgaatttc
tcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgat
aaacgctatctcccagatgacgaagagccaataactcaagaagaacagatcatgggaaca
gatgaatcccaggagagcagcatgacagatgcagacgacacacaactacatgcagctgaa
agtgatgaattttaa

DBGET integrated database retrieval system