KEGG   Oryctolagus cuniculus (rabbit): 100345225
Entry
100345225         CDS       T03373                                 
Symbol
TICAM2
Name
(RefSeq) toll-like receptor adaptor molecule 2
  KO
K05409  TRIF-related adaptor molecule
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04217  Necroptosis
ocu04620  Toll-like receptor signaling pathway
ocu05133  Pertussis
ocu05161  Hepatitis B
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100345225 (TICAM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100345225 (TICAM2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100345225 (TICAM2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100345225 (TICAM2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100345225 (TICAM2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100345225 (TICAM2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100345225 (TICAM2)
SSDB
Motif
Pfam: TIR_2 TIR
Other DBs
NCBI-GeneID: 100345225
NCBI-ProteinID: NP_001191275
UniProt: G1TGG7
LinkDB
Position
3:complement(411072..426155)
AA seq 241 aa
MGVGKSKAGSCPLSFSRGESHGVDTRPGPPGSSSRRCAEAALGEGAERGGATREPVQERE
VPVGLAEAPAAGEEEEEEEEEEEFLKFVILHAEEDTDEALRVQSLLQDEFGISPGMVFAE
MPCGRQHLQNLDAAVNGSAWTILLLTENFLRDTWCRFQFYTSLMNSVNRLHKYNSVIPMR
PLNNPLPRERTPLALQTINALEEEGRGFATQVERIFQESVFRTQQAIWRETRSAAQRQLV
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgggtgtcggcaagtccaaagcaggttcctgccccctgtccttctcccggggtgagagc
cacggcgtggacacacgtccgggacctcccgggtcaagttccaggagatgtgcagaggcc
gccctgggtgagggtgctgagcgtggcggtgctaccagggagccagtgcaagagcgggag
gtgcctgtgggcctggcggaggctcccgcggcaggcgaggaggaggaggaggaggaggag
gaggaggagttcctcaagtttgtgatcctacacgcggaagaggacacggacgaagcgctg
cgggtgcagagcctgctgcaggacgagttcggcatcagccccgggatggtcttcgcggag
atgccgtgcggcagacagcacctgcagaacctcgacgccgcggtcaacggctcggcctgg
accatcttgctgctgaccgagaacttcctgcgcgacacctggtgcagattccagttctac
acgtccctgatgaactcggtgaacaggctgcacaaatacaactccgtcatccccatgcgg
cccctgaacaaccccctgccccgggaaaggacgcccctggccctgcagaccatcaacgcc
ctggaggaggaaggccgcggctttgctacccaggtggagaggatcttccaggagtccgtg
ttcaggacccagcaagccatctggagagagacgagaagcgcagcgcagagacagcttgtc
gcctga

DBGET integrated database retrieval system