KEGG   Oryctolagus cuniculus (rabbit): 100345257
Entry
100345257         CDS       T03373                                 
Symbol
ROBO2
Name
(RefSeq) roundabout guidance receptor 2
  KO
K06754  roundabout, axon guidance receptor 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100345257 (ROBO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100345257 (ROBO2)
   04515 Cell adhesion molecules [BR:ocu04515]
    100345257 (ROBO2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100345257 (ROBO2)
Cell adhesion molecules [BR:ocu04515]
 Immunoglobulin superfamily
  ROBO family
   100345257 (ROBO2)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set Ig_5 C2-set_2 Ig_6 Ig_4 Pur_ac_phosph_N Adeno_E3_CR1
Other DBs
NCBI-GeneID: 100345257
NCBI-ProteinID: XP_008265341
Ensembl: ENSOCUG00000004278
LinkDB
Position
14:complement(139979739..140600791)
AA seq 1515 aa
MSLLMFTQVLLCGFLYFRVDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTP
TIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAV
SRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKIRIDDKEER
ISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEE
AVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIRDDYTLRIKKAMSTDEGTYMCIAENRVG
KVESSATLTVRARPVAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLL
FPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRP
PPIILQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFLGRDPRATIQEQGTLQIK
NLRNSDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLNDLPGPPSKPQVTDVTKN
SVTLSWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVR
AINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVIVRLHTPVVLTPTTVQVTW
TVDRQPQFIQGYRVMYRQTSGLQAASTWQHLDAKVPTERSAVLVNLRKGVTYEIKVRPYF
NEFQGMDSESKSARTTEEAPSAPPQSVTVLTVGSQNSTSISVSWDPPPPDHQNGIIQEYK
IWCLGNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGGR
NEVVITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVT
FQRGDGGLMSNGSRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGANEIGNFGRGDVLPP
VPGQGDKTATMLSDGAIYSSIDFTTKTTYNSSSQITQATPYATTQILHSNSIHELAVDLP
DPQWKSSIQQKTDLMGFGYSLPDQNKGNNALLYIPDYRLAEGLSNRMPHNQSQDFSTTSS
HNSSERSGSLSGGKGGKKKKNKNSSKPQKNNGSAWANVPLPPPPVQPLPGTELEHYAVEQ
QENGYDSDSWCPPLPVQTYLHQGMEDELEEDDDRVPTPPVRGVASSPAISFGQQSTATLT
PSPREEMQPMLQAHLDELTRAYQFDLAKQTWHIQSNNQPPQPPVPPLGYVSGALISDLET
DVADDDADDEEEALETPRPLRALDQTPGSSMDNLDSSLAGKAFTSSQRPRPTSPFSTDSN
TSAAVSQNQRPRPTKKHKGGRMDQQPAMPHRREGVTDDLPPPPDPPPGQGLRQQIGPSQH
AGNVENSTEGKGSSLERQHAANLEDTRSSLECPARASLDWQRQTQEWISSTERQEDIRKG
PHKQGVGTEEALVPYSKPTFPSPGGHSSSGTASSKGSTGPRKTEVMRGGHQRNASDLLDM
GYMGSNSQGQFTGEL
NT seq 4548 nt   +upstreamnt  +downstreamnt
atgagtctgctgatgtttacacaagtactgctctgtggatttttatactttcgggtggac
ggatctcgtcttcgccaggaagactttcccccacggatcgtggaacacccttcagatgtc
atcgtctctaagggcgagcccaccactctgaactgtaaggcggagggccgaccaacaccc
accattgagtggtacaaggatggggagcgcgtggagacagacaaagatgatccccgatcc
cataggatgcttctgcccagtggatcgttattcttcttgcgcatcgtgcatggacgcaga
agtaaacccgatgaaggaagttacgtgtgtgttgcaaggaactatctcggcgaagcagtg
agtcgaaatgcatctctggaagtggcattgttacgagatgactttcggcaaaaccccaca
gatgttgtggtggcagctggcgagcccgcaatcctggagtgccagcctccccggggacac
ccagaacctaccatctactggaaaaaggacaaaattcgaatcgatgacaaggaagagaga
ataagtattcgaggtggaaaactgatgatctccaataccagaaaaagtgacgcaggaatg
tacacctgtgtgggcaccaatatggtgggagaaagagacagtgacccagcagagctgact
gtctttgaacgacccacgttcctcaggaggccaattaatcaggtggtgctggaggaagaa
gctgtagaatttcgctgtcaggtccaaggagatcctcaaccaactgtgaggtggaaaaag
gatgatgcagacttgccaagaggaaggtatgacatcagagatgattacacactgagaatt
aaaaaggccatgagtacagatgaaggcacctatatgtgtattgcggagaatcgagtggga
aaggtggagtcctctgctaccctcacagtccgagctcgccctgttgctcctccacaattt
gtggttaggccaagagatcagattgttgctcaaggtcggacagtgacatttccctgtgaa
actaaaggaaacccacagccagctgttttttggcagaaagaaggaagccagaacctactt
ttcccaaaccaaccccagcagcccaacagtagatgttcagtgtcgccaactggagacctc
accattaccaacattcagcgttcagatgcaggttactacatatgccaggccttaactgtg
gcaggaagcattttagcaaaggcacaactggaagttactgatgttttgacagatcgacct
ccacccataattctacaaggcccagccaatcagacactagcagtagatggtacagcatta
ctgaaatgtaaagccactggtgatcctcttcctgtaattagctggttaaaggagggattc
acttttctgggtagagatccaagagcgaccatacaagagcaaggaacactgcagattaag
aatttacggaattcagatactggcacttacacctgtgtggctacaagttcaagtggagag
acttcctggagtgcagtgctggatgtgactgaatctggagcaacaatcagtaaaaattat
gatttgaatgacctgccagggccaccatccaaaccacaggtcactgatgttactaagaac
agtgtcaccttatcctggcaaccaggtacccctggaacccttccagcaagtgcatatatc
attgaggctttcagccaatccgtgagcaacagctggcagacagtggccaaccacgtaaag
accaccctctatactgtgagaggactgcgccctaatacaatctacttgttcatggtcaga
gcaatcaacccccaaggtctcagtgacccaagtcctatgtcagatcctgtccgcacccaa
gacatcagtcctccagcacaaggagtagatcacaggcaagtccagaaagaactaggagat
gtcattgttcgtcttcatactccagttgtgttgaccccaaccactgttcaagtcacgtgg
acggttgatcgccagccccagtttattcaaggctaccgagtgatgtaccgtcagacctca
ggcctgcaggctgcatctacatggcagcatctagatgccaaggtcccgactgagaggagc
gccgtcttggtcaacctgagaaagggagtgacttacgaaattaaagtgcggccgtatttt
aacgagttccaaggaatggatagtgagtctaaatcagcccgcacaaccgaagaagccccc
agtgcccctccacagtctgtcactgtactgaccgtcggaagccagaacagcacaagcatt
agtgtttcctgggatcctcctcctccagatcaccagaatggaatcatccaagaatataag
atttggtgtctgggaaatgaaacacgattccatatcaacaaaactgtggacgcagccatt
cgttctgtaataattggtggattattcccaggtattcaatacagagtagaggttgcagcc
agtaccagtgcaggagttggtgtaaaaagcgagccacagccaatcataattgggggacgt
aatgaagttgttattactgaaaataacaacagcataactgagcaaatcactgatgttgtg
aagcaaccagcctttatagctgggattggtggtgcctgctgggtaattttgatgggtttt
agcatctggttgtattggcgaagaaagaagagaaagggactcagtaattatgctgttaca
tttcaaagaggagatggaggactaatgagcaatggaagccgtccaggtcttctaaatgct
ggtgatcccagttatccgtggcttgctgattcatggccggccacaagcttgccagtaaac
aacagcaacagtggcgcaaacgaaattgggaattttggccgtggagatgtgctgccacca
gttccaggccaaggggataaaacagcaacaatgctctcagatggagccatttatagcagc
attgacttcacgaccaaaaccacttacaacagttccagccaaataacacaggctacccca
tatgccacaacacagatcttgcattctaacagcatacatgaactggctgttgatctgcct
gatccacaatggaaaagctccattcagcaaaaaacagatctgatgggatttggttattct
ctgcctgatcagaacaaaggtaacaatgccttactttacatccctgactaccgattggct
gagggattgtctaatagaatgccacacaaccagtcacaggatttcagcaccaccagctct
cacaacagctcagaaaggagtggcagtctctcaggtggaaaaggtgggaaaaagaagaaa
aataaaaactcttctaaaccacagaaaaacaatggatctgcctgggccaatgtgcctcta
cctcctcccccagttcagccccttcctggcacagaactagaacactatgcggtagaacag
caagaaaatggctatgacagcgatagctggtgcccaccattaccagtgcaaacatacttg
caccagggtatggaagatgaactggaagaagatgatgaccgagtcccaacccctcctgtc
cgaggtgtggcctcctctcctgccatctcctttggacagcagtctactgcaacactcact
ccatccccgcgggaggagatgcagcccatgctgcaggctcacctggacgagttgacgagg
gcctatcagtttgacctagcaaagcaaacatggcacattcaaagcaataatcaaccgcca
cagccaccagtaccaccattaggttatgtgtctggagccttgatttcggacttggaaaca
gatgttgcagatgatgatgctgacgatgaagaggaagctttggaaacccccaggcccctg
agagcactagaccagacaccgggatccagtatggacaatctagacagctctctggcagga
aaagcttttacctcctctcaaagacctcgacccaccagcccattttctactgacagtaat
accagtgcagccgtgagtcaaaatcagaggcctaggcccactaaaaaacacaagggaggg
cgaatggaccaacaaccagcaatgcctcatcgaagagaaggagtgacagatgatcttcca
ccaccaccagaccccccaccaggtcagggtttaaggcagcaaataggcccgagccagcat
gctggtaacgtggaaaactcaacagagggaaaaggaagctcactagagagacaacatgca
gccaacttagaagacacaaggagctccttggagtgtccagctagagcctccctagactgg
cagcgacaaacccaagagtggataagctctacagaacgccaagaagatatacggaaaggc
ccacacaaacaaggtgtcggaacagaggaggccttggtgccctacagcaagcccaccttc
ccatctccaggcggccacagttcatcaggaacagcttcttctaaaggatccactggacct
aggaaaaccgaggtgatgaggggaggccaccagcgtaatgccagcgaccttctggacatg
ggctatatgggttcaaatagtcaaggacagtttacaggtgaattatag

DBGET integrated database retrieval system